(data stored in ACNUC7421 zone)

EMBL: CP002355.PE272

CP002355.PE272       Location/Qualifiers
FT   CDS             263977..264600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0273"
FT                   /product="NADH dehydrogenase subunit I"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1143 Formate hydrogenlyase subunit
FT                   6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I);
FT                   InterPro IPR017900: IPR010226: IPR017896; KEGG:
FT                   tdn:Suden_1820 NADH dehydrogenase subunit I; SPTR:
FT                   NADH-quinone oxidoreductase subunit I; TIGRFAM:
FT                   NADH-quinone oxidoreductase, chain I; PFAM: 4Fe-4S binding
FT                   domain; TIGRFAM: NADH-quinone oxidoreductase, chain I"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32940"
FT                   /db_xref="GOA:E4TYG3"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG3"
FT                   /protein_id="ADR32940.1"
FT                   /translation="MHHEEVFTDRNVSEHSAYYYVDIEAYPESGWDKFKQVLKRALRGE
FT                   LFVGLWVVLREMIKFDIHTVQYPKEKLPIGPRYRAVHKLLRLWESGYERCIGCGLCEKI
FT                   CISDCIRMDTRIDENSRKEVTEYSINLGRCIFCGYCAEVCPELAIVHGQRYENASEQRA
FT                   HFVIKDDMLTPLDLLKAGEQAEYPGFGAIIPGSDASVKKTPLAY"
     MHHEEVFTDR NVSEHSAYYY VDIEAYPESG WDKFKQVLKR ALRGELFVGL WVVLREMIKF        60
     DIHTVQYPKE KLPIGPRYRA VHKLLRLWES GYERCIGCGL CEKICISDCI RMDTRIDENS       120
     RKEVTEYSIN LGRCIFCGYC AEVCPELAIV HGQRYENASE QRAHFVIKDD MLTPLDLLKA       180
     GEQAEYPGFG AIIPGSDASV KKTPLAY                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page