(data stored in ACNUC7421 zone)

EMBL: CP002355.PE273

CP002355.PE273       Location/Qualifiers
FT   CDS             264610..265197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0274"
FT                   /product="NADH dehydrogenase subunit J"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0839 NADH:ubiquinone oxidoreductase subunit
FT                   6 (chain J); InterPro IPR001457; KEGG: tdn:Suden_1819 NADH
FT                   dehydrogenase subunit J; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 6; SPTR:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase, chain 6;
FT                   PFAM: NADH-ubiquinone/plastoquinone oxidoreductase chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32941"
FT                   /db_xref="GOA:E4TYG4"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG4"
FT                   /protein_id="ADR32941.1"
FT                   /translation="MFEAIAFYLFAALTIVMFTITVMTSQALYAITAMAAGMIFISAFF
FT                   FILGADFLGAIQIIVYTGAVMALYAFGMMFFDTTRDVVEKRTNPQIVFVLGVLAAVMVV
FT                   AIFVAPIVSNNIQALYPIQENIGNSQAVGMVLFTKYLVPFEVAAVMLLVAMIGGIILAG
FT                   KKMDKSLTLMAEEEISTMDDMTEEEVQAGGHH"
     MFEAIAFYLF AALTIVMFTI TVMTSQALYA ITAMAAGMIF ISAFFFILGA DFLGAIQIIV        60
     YTGAVMALYA FGMMFFDTTR DVVEKRTNPQ IVFVLGVLAA VMVVAIFVAP IVSNNIQALY       120
     PIQENIGNSQ AVGMVLFTKY LVPFEVAAVM LLVAMIGGII LAGKKMDKSL TLMAEEEIST       180
     MDDMTEEEVQ AGGHH                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page