(data stored in ACNUC7421 zone)

EMBL: CP002355.PE274

CP002355.PE274       Location/Qualifiers
FT   CDS             265197..265502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0275"
FT                   /product="NADH dehydrogenase subunit K"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0713 NADH:ubiquinone oxidoreductase subunit
FT                   11 or 4L (chain K); InterPro IPR001133; KEGG:
FT                   tdn:Suden_1818 NADH dehydrogenase subunit K; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 4L; SPTR: NADH-quinone
FT                   oxidoreductase chain 11; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32942"
FT                   /db_xref="GOA:E4TYG5"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG5"
FT                   /protein_id="ADR32942.1"
FT                   /translation="MEVTLSHYLVLSSILFSIGLIGVMRRKNLLMLFFATEILLNATNI
FT                   AFAAISHYIGDLSGQMFAFFIIAIAASEVAIGLGLLIVWYKRTGKIDLDQMNSMRG"
     MEVTLSHYLV LSSILFSIGL IGVMRRKNLL MLFFATEILL NATNIAFAAI SHYIGDLSGQ        60
     MFAFFIIAIA ASEVAIGLGL LIVWYKRTGK IDLDQMNSMR G                           101
//

If you have problems or comments...

PBIL Back to PBIL home page