(data stored in ACNUC7421 zone)

EMBL: CP002355.PE275

CP002355.PE275       Location/Qualifiers
FT   CDS             265506..267392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0276"
FT                   /product="NADH dehydrogenase subunit L"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1009 NADH:ubiquinone oxidoreductase subunit
FT                   5 (chain L)/Multisubunit Na+/H+ antiporter MnhA subunit;
FT                   InterProIPR003945: IPR003916: IPR018393: IPR001516: IPR
FT                   001750: IPR010934; KEGG: tdn:Suden_1817 NADH dehydrogenase
FT                   subunit L; PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   NADH-Ubiquinone oxidoreductase (complex I) chain 5/L domain
FT                   protein; NADH dehydrogenase subunit 5 domain protein; SPTR:
FT                   NADH-plastoquinone oxidoreductase, chain 5; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain L;
FT                   PFAM: NADH-Ubiquinone/plastoquinone (complex I), various
FT                   chains; NADH-Ubiquinone oxidoreductase (complex I), chain 5
FT                   N-terminus; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain L"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32943"
FT                   /db_xref="GOA:E4TYG6"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG6"
FT                   /protein_id="ADR32943.1"
FT                   /translation="MELYLYIALFAPLVGSLFSALFTATPKSSITGYVASGLLFTSFVS
FT                   SAILLNYVMGGHTVHVEMMTWMATGDLYIPFGFVVDQVSVVMMMVVTIVSTVVHVYSIG
FT                   YMDHDKGFNRFFAWLSAFVFSMMVLVMSDNFAGLFIGWEGVGLCSWGLIGFWYHKESAT
FT                   WAANEAFIMNRIADLGMLIGIFLIYWNVGSLQYDVVFAEVGNLQPVIITWIGIFLFIGA
FT                   MGKSAQFPLHTWLADAMEGPTPVSALIHAATMVTAGVYLVVRANPIYDLIPNVGIFIAS
FT                   LGAFVALFAASMALVNRDMKRIIAYSTLSQLGYMFVAAGLGAYWVALFHLMAHAFFKAL
FT                   LFLGAGNVMHAMHDELDPFKMGGLRKVMKGTFVMMTLASVALAGIYPFAGFFSKDLILE
FT                   VGFVEHHYVIYTVLLLTAGLTAFYSFRLVALIFHGEERYKLFGIHPHEAYKFMLVAMSP
FT                   LLVLAIIAGSFKMTYYQLVINLLPSTQYHVHSATTFWIMTIGTQLFVILAILFAYKKYS
FT                   NWNSVPDGTSKMEKSFGYKLLWNQYYIPKIYDEVFSKPYLELSKIAWKQIDLKIVDATV
FT                   DAIANAIYKTGENTRDIQNGNLSSMLRWMVVGLVVLMTLAVAFNVGYNVFGA"
     MELYLYIALF APLVGSLFSA LFTATPKSSI TGYVASGLLF TSFVSSAILL NYVMGGHTVH        60
     VEMMTWMATG DLYIPFGFVV DQVSVVMMMV VTIVSTVVHV YSIGYMDHDK GFNRFFAWLS       120
     AFVFSMMVLV MSDNFAGLFI GWEGVGLCSW GLIGFWYHKE SATWAANEAF IMNRIADLGM       180
     LIGIFLIYWN VGSLQYDVVF AEVGNLQPVI ITWIGIFLFI GAMGKSAQFP LHTWLADAME       240
     GPTPVSALIH AATMVTAGVY LVVRANPIYD LIPNVGIFIA SLGAFVALFA ASMALVNRDM       300
     KRIIAYSTLS QLGYMFVAAG LGAYWVALFH LMAHAFFKAL LFLGAGNVMH AMHDELDPFK       360
     MGGLRKVMKG TFVMMTLASV ALAGIYPFAG FFSKDLILEV GFVEHHYVIY TVLLLTAGLT       420
     AFYSFRLVAL IFHGEERYKL FGIHPHEAYK FMLVAMSPLL VLAIIAGSFK MTYYQLVINL       480
     LPSTQYHVHS ATTFWIMTIG TQLFVILAIL FAYKKYSNWN SVPDGTSKME KSFGYKLLWN       540
     QYYIPKIYDE VFSKPYLELS KIAWKQIDLK IVDATVDAIA NAIYKTGENT RDIQNGNLSS       600
     MLRWMVVGLV VLMTLAVAFN VGYNVFGA                                          628
//

If you have problems or comments...

PBIL Back to PBIL home page