(data stored in ACNUC7421 zone)

EMBL: CP002355.PE276

CP002355.PE276       Location/Qualifiers
FT   CDS             267402..268949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0277"
FT                   /product="NADH dehydrogenase subunit M"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1008 NADH:ubiquinone oxidoreductase subunit
FT                   4 (chain M); InterPro IPR010227: IPR003918: IPR001750;
FT                   KEGG: tdn:Suden_1816 NADH dehydrogenase subunit M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); SPTR:
FT                   Donor-ubiquinone reductase I; TIGRFAM: proton-translocating
FT                   NADH-quinone oxidoreductase, chain M; PFAM:
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32944"
FT                   /db_xref="GOA:E4TYG7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG7"
FT                   /protein_id="ADR32944.1"
FT                   /translation="MIDHILTLLIFFPALAAMLGFVVTKDSMRAYGIAVAFIEFVLSLW
FT                   LWYAYDPMISGMQFMESMPLIPAFGINYLLGVDGISLFIIILSTFFTLIGIASLTEKRR
FT                   IKDLIITLLFLEMTMVGVFAALDAIVFYVFWELSLVPMLYIIGAWGGPLRIYASIKFFL
FT                   YTFTGSLVMLVGMLFMAYFYYQATGQWSFSILEWYRLILPENFQLWLFAAFFLGFAIKV
FT                   PMFPFHTWLPYAHGQAPTIGSVILAAILLKMGTYAFVRFSLPLFPDASVFFMFPIAIIA
FT                   IIMIIYTAMVAYAQEDIKQVVAYSSVSHMGVIILGTFALNVEGVSGSVFLMLAHGVVSG
FT                   ALFLLVGVIYDRRHTKLMSEFGGLASVMPRYATIFGIMMMASVGLPLTINFVGEFLSLL
FT                   GFYKQSHMLTLTAGVAIIVGAIYMLSAYKKAFFGPVTNEANRHLKDVNRTELLGLIPLV
FT                   IVAIWLGVYPKPVLEPINNSVESVIQLMHDKAQSPEAKERIPDLSGKNGIISMKEAN"
     MIDHILTLLI FFPALAAMLG FVVTKDSMRA YGIAVAFIEF VLSLWLWYAY DPMISGMQFM        60
     ESMPLIPAFG INYLLGVDGI SLFIIILSTF FTLIGIASLT EKRRIKDLII TLLFLEMTMV       120
     GVFAALDAIV FYVFWELSLV PMLYIIGAWG GPLRIYASIK FFLYTFTGSL VMLVGMLFMA       180
     YFYYQATGQW SFSILEWYRL ILPENFQLWL FAAFFLGFAI KVPMFPFHTW LPYAHGQAPT       240
     IGSVILAAIL LKMGTYAFVR FSLPLFPDAS VFFMFPIAII AIIMIIYTAM VAYAQEDIKQ       300
     VVAYSSVSHM GVIILGTFAL NVEGVSGSVF LMLAHGVVSG ALFLLVGVIY DRRHTKLMSE       360
     FGGLASVMPR YATIFGIMMM ASVGLPLTIN FVGEFLSLLG FYKQSHMLTL TAGVAIIVGA       420
     IYMLSAYKKA FFGPVTNEAN RHLKDVNRTE LLGLIPLVIV AIWLGVYPKP VLEPINNSVE       480
     SVIQLMHDKA QSPEAKERIP DLSGKNGIIS MKEAN                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page