(data stored in ACNUC7421 zone)

EMBL: CP002355.PE277

CP002355.PE277       Location/Qualifiers
FT   CDS             268949..270454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0278"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1007 NADH:ubiquinone oxidoreductase subunit
FT                   2 (chain N); InterPro IPR010096: IPR001750; KEGG:
FT                   tdn:Suden_1815 NADH dehydrogenase subunit N; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); SPTR:
FT                   NADH-quinone oxidoreductase subunit N; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain N;
FT                   PFAM: NADH-Ubiquinone/plastoquinone (complex I), various
FT                   chains; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain N"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32945"
FT                   /db_xref="GOA:E4TYG8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG8"
FT                   /protein_id="ADR32945.1"
FT                   /translation="MLEPIHVSLASLNLATLAPMLIAIVGALGILVIDMVKGGLNKTLY
FT                   VMVSLLFLLLDLGALVDFAGVFIKNGTVLGFFDVMLMDGIAILSQIIIVVGSMLFIPLA
FT                   LTSKRFHEYNYPEYFALFLFMIAGFQFMVATDNLILIFVGLETASLALYTLIALHNRSK
FT                   SFEAAVKYFTMGALAAGFYAFGSMILYAISGSVEINQIATILAEDHYRNIGFVLLAMAF
FT                   MIAAFGFKLSMVPFHTWTPDVYEGSSAALAGYMSIVPKIAAFVVAMRLFEFLVHSGIVW
FT                   LQVILYIGVVVTMTASNIWALVQTDVKRMLAYSSISHAGFVMSAILIGTTQANTGLFLY
FT                   WALFSFTNLGAFTMLWVNRQKNLLPGQSSDHPYEKFSGMIKTMPMGAVMMGLFMLSLAG
FT                   IPPFGLFWGKMYMIGAAVSAGYTVLALIMALNSAIAGYYYLKLIVFMFMKEPRVGYEKY
FT                   YFMNASLSLRTIIGLAAVGTIFAVFAVNPLLKVITLFVYNSGY"
     MLEPIHVSLA SLNLATLAPM LIAIVGALGI LVIDMVKGGL NKTLYVMVSL LFLLLDLGAL        60
     VDFAGVFIKN GTVLGFFDVM LMDGIAILSQ IIIVVGSMLF IPLALTSKRF HEYNYPEYFA       120
     LFLFMIAGFQ FMVATDNLIL IFVGLETASL ALYTLIALHN RSKSFEAAVK YFTMGALAAG       180
     FYAFGSMILY AISGSVEINQ IATILAEDHY RNIGFVLLAM AFMIAAFGFK LSMVPFHTWT       240
     PDVYEGSSAA LAGYMSIVPK IAAFVVAMRL FEFLVHSGIV WLQVILYIGV VVTMTASNIW       300
     ALVQTDVKRM LAYSSISHAG FVMSAILIGT TQANTGLFLY WALFSFTNLG AFTMLWVNRQ       360
     KNLLPGQSSD HPYEKFSGMI KTMPMGAVMM GLFMLSLAGI PPFGLFWGKM YMIGAAVSAG       420
     YTVLALIMAL NSAIAGYYYL KLIVFMFMKE PRVGYEKYYF MNASLSLRTI IGLAAVGTIF       480
     AVFAVNPLLK VITLFVYNSG Y                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page