(data stored in ACNUC7421 zone)

EMBL: CP002355.PE278

CP002355.PE278       Location/Qualifiers
FT   CDS             270476..272833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0279"
FT                   /product="Tetratricopeptide TPR_1 repeat-containing
FT                   protein"
FT                   /note="InterPro IPR019734: IPR013026: IPR001440; KEGG:
FT                   tdn:Suden_1814 TPR repeat-containing protein; PFAM:
FT                   Tetratricopeptide TPR_1 repeat-containing protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32946"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG9"
FT                   /protein_id="ADR32946.1"
FT                   /translation="MKFWIILSLCLPLFGLELSIQSGKEEGEKFSILHLRHTVPFACKA
FT                   MDDEFGETKRIECYLPTPPKQNFSPIDNGQLLVSSSTTSNGYTITVLPKSKIKLIPVLF
FT                   NLTKTKETYQNDAKKAFHWNIVGYQSNLPLISLSSSSATAINFPIKIAKSPPPFVGGLD
FT                   LKGNPIKITRVQDVTDYMEMKKAYAAKNYIKVIDRAENTLKEYPNTVFKNELMLYQIRS
FT                   YHQLGEFEKVLALSKRFLREFSSDPGLAEVLTYTANAYSKIGQITDADYFFDRLFDEQG
FT                   DSPFAPQGMIYKAEQLETNGEPKKAAQYYKKALSSTTDVAIASKAAFKLAQSELMSGDV
FT                   QKAAQYVDKIITVNPDYFSEVTDDAINMATSFMDKKDPKTAARLTEALLNKSDKKSDNY
FT                   QLLLKNLGLQLAKAGKRGEALKRFNEYLESFKYGDYAEEVRRAKDGLFFNEGDTNTTEE
FT                   IKKYNDLIDRYGDDSVGRKALYKKAQLLLKEKKYKEVLDIESDLYRLDSTEYPETNQLI
FT                   SKSAIGFEKSLLKEGKCADAMKFQKMYKIKLLPEWDESLFNCALKTAQYPTAKKIAQSH
FT                   LKSNSVAERQIWLFRMVKTQFGLGEYKAASKGGEELITLLGVQKNPPLNEIYRIMFDAA
FT                   QRVGDSDAMIRNIKSIEGVFPNDFTDIERYTQMVSLGLKRKDEAMTQTYSRKVITLQER
FT                   TKSYTQSPYIEFTLAQSYQNLGKDTDALNVLKTLNKQKLNTEKRARQQYLIGAIEQKLG
FT                   RKREARDAFNASIKADKNSAWGKLAKDALALF"
     MKFWIILSLC LPLFGLELSI QSGKEEGEKF SILHLRHTVP FACKAMDDEF GETKRIECYL        60
     PTPPKQNFSP IDNGQLLVSS STTSNGYTIT VLPKSKIKLI PVLFNLTKTK ETYQNDAKKA       120
     FHWNIVGYQS NLPLISLSSS SATAINFPIK IAKSPPPFVG GLDLKGNPIK ITRVQDVTDY       180
     MEMKKAYAAK NYIKVIDRAE NTLKEYPNTV FKNELMLYQI RSYHQLGEFE KVLALSKRFL       240
     REFSSDPGLA EVLTYTANAY SKIGQITDAD YFFDRLFDEQ GDSPFAPQGM IYKAEQLETN       300
     GEPKKAAQYY KKALSSTTDV AIASKAAFKL AQSELMSGDV QKAAQYVDKI ITVNPDYFSE       360
     VTDDAINMAT SFMDKKDPKT AARLTEALLN KSDKKSDNYQ LLLKNLGLQL AKAGKRGEAL       420
     KRFNEYLESF KYGDYAEEVR RAKDGLFFNE GDTNTTEEIK KYNDLIDRYG DDSVGRKALY       480
     KKAQLLLKEK KYKEVLDIES DLYRLDSTEY PETNQLISKS AIGFEKSLLK EGKCADAMKF       540
     QKMYKIKLLP EWDESLFNCA LKTAQYPTAK KIAQSHLKSN SVAERQIWLF RMVKTQFGLG       600
     EYKAASKGGE ELITLLGVQK NPPLNEIYRI MFDAAQRVGD SDAMIRNIKS IEGVFPNDFT       660
     DIERYTQMVS LGLKRKDEAM TQTYSRKVIT LQERTKSYTQ SPYIEFTLAQ SYQNLGKDTD       720
     ALNVLKTLNK QKLNTEKRAR QQYLIGAIEQ KLGRKREARD AFNASIKADK NSAWGKLAKD       780
     ALALF                                                                   785
//

If you have problems or comments...

PBIL Back to PBIL home page