(data stored in ACNUC7421 zone)

EMBL: CP002355.PE28

CP002355.PE28        Location/Qualifiers
FT   CDS             complement(29804..30568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0028"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="COGs: COG2334 Putative homoserine kinase type II
FT                   (protein kinase fold); InterPro IPR002575; KEGG:
FT                   ant:Arnit_1841 aminoglycoside phosphotransferase; PFAM:
FT                   aminoglycoside phosphotransferase; SPTR: Aminoglycoside
FT                   phosphotransferase; PFAM: Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32696"
FT                   /db_xref="GOA:E4TW80"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW80"
FT                   /protein_id="ADR32696.1"
FT                   /translation="MGVKRVITLSDLPASLGVQTLASSTDGVMDSVYFLDDDRVVKIFE
FT                   TASEEAVAEELKLLIHCGSLHVSRAEGGVFRVQNKPALIYRRCRGESLKDAGIDEIRQI
FT                   GAFLRDFHHLTAGRRSTNERLFEKSRLARMIRETHTDIFDTLLKKNDLTLRDEGIIHGD
FT                   LFLDNALFLEGRLSCVIDFTQACNGDFLFDLAVTDLSWCDSDEKTEALLKSYGATLTLD
FT                   EFRPYREYATLFYCVNRYLNGGNYQELLEKLV"
     MGVKRVITLS DLPASLGVQT LASSTDGVMD SVYFLDDDRV VKIFETASEE AVAEELKLLI        60
     HCGSLHVSRA EGGVFRVQNK PALIYRRCRG ESLKDAGIDE IRQIGAFLRD FHHLTAGRRS       120
     TNERLFEKSR LARMIRETHT DIFDTLLKKN DLTLRDEGII HGDLFLDNAL FLEGRLSCVI       180
     DFTQACNGDF LFDLAVTDLS WCDSDEKTEA LLKSYGATLT LDEFRPYREY ATLFYCVNRY       240
     LNGGNYQELL EKLV                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page