(data stored in ACNUC7421 zone)

EMBL: CP002355.PE281

CP002355.PE281       Location/Qualifiers
FT   CDS             274730..275251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1810 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32949"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH2"
FT                   /protein_id="ADR32949.1"
FT                   /translation="MSDIRLVQATIDLAYEEVLDNNEKFEHEFNLIGVAEENSITQGIK
FT                   HVKVRGELDETNALMLNIMAELYRKMEKIEMLLSNGKINRLELSSKGLIDSIGLEHFKL
FT                   SSDSLEVGKHYYGRMEIATFPKREIALYFEAVEPSLAKIENIHVRDKEAWGYYMTACER
FT                   VMIRQMKGLE"
     MSDIRLVQAT IDLAYEEVLD NNEKFEHEFN LIGVAEENSI TQGIKHVKVR GELDETNALM        60
     LNIMAELYRK MEKIEMLLSN GKINRLELSS KGLIDSIGLE HFKLSSDSLE VGKHYYGRME       120
     IATFPKREIA LYFEAVEPSL AKIENIHVRD KEAWGYYMTA CERVMIRQMK GLE              173
//

If you have problems or comments...

PBIL Back to PBIL home page