(data stored in ACNUC7421 zone)

EMBL: CP002355.PE282

CP002355.PE282       Location/Qualifiers
FT   CDS             275248..275763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1809 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32950"
FT                   /db_xref="GOA:E4TYH3"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH3"
FT                   /protein_id="ADR32950.1"
FT                   /translation="MNHSIEIALVALAVVVVGLIYYVVTKESEVSTQIRSIAKVVEDLH
FT                   RELFMMDKRLKQELEIITSLQESVPREQTSLHAELGREVNELSVPILESLTHIEESFGG
FT                   YKEKTENRLRYLEERIRNLSLPTSISGLDDEKVISRYNQGIEIDAIAKELRLSKAEVEF
FT                   VLKINQLR"
     MNHSIEIALV ALAVVVVGLI YYVVTKESEV STQIRSIAKV VEDLHRELFM MDKRLKQELE        60
     IITSLQESVP REQTSLHAEL GREVNELSVP ILESLTHIEE SFGGYKEKTE NRLRYLEERI       120
     RNLSLPTSIS GLDDEKVISR YNQGIEIDAI AKELRLSKAE VEFVLKINQL R                171
//

If you have problems or comments...

PBIL Back to PBIL home page