(data stored in ACNUC7421 zone)

EMBL: CP002355.PE283

CP002355.PE283       Location/Qualifiers
FT   CDS             complement(275894..276640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0284"
FT                   /product="protein of unknown function DUF218"
FT                   /note="COGs: COG1434 conserved hypothetical protein;
FT                   InterPro IPR003848; KEGG: sun:SUN_1551 hypothetical
FT                   protein; PFAM: protein of unknown function DUF218; SPTR:
FT                   Putative uncharacterized protein; PFAM: DUF218 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32951"
FT                   /db_xref="GOA:E4TYH4"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH4"
FT                   /protein_id="ADR32951.1"
FT                   /translation="MFELKKLISSFIYPFPIFLISSALALYLLQRGNRRRAKILFVFSF
FT                   AWITILSYPPFSALLLKPLENAYPKVQLHSPFPRYIHVLGNGHTSSQNIPLSSELSLTS
FT                   LARVNEGILLYKSHPGMKLIFSGYGGGDSVSNARKNSQLAIALGVNSNDIVILEEAKDT
FT                   AEEAIAVKKIVGSQPLILVTSASHMVRASSIFRKNGICVIEAPTDFLVKKEDTLWQFPS
FT                   SGGLRRSECAFHEYLGLLWEKLKGSL"
     MFELKKLISS FIYPFPIFLI SSALALYLLQ RGNRRRAKIL FVFSFAWITI LSYPPFSALL        60
     LKPLENAYPK VQLHSPFPRY IHVLGNGHTS SQNIPLSSEL SLTSLARVNE GILLYKSHPG       120
     MKLIFSGYGG GDSVSNARKN SQLAIALGVN SNDIVILEEA KDTAEEAIAV KKIVGSQPLI       180
     LVTSASHMVR ASSIFRKNGI CVIEAPTDFL VKKEDTLWQF PSSGGLRRSE CAFHEYLGLL       240
     WEKLKGSL                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page