(data stored in ACNUC7421 zone)

EMBL: CP002355.PE284

CP002355.PE284       Location/Qualifiers
FT   CDS             complement(276658..276987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0285"
FT                   /product="iojap-like protein"
FT                   /note="COGs: COG0799 Iojap protein; InterPro IPR004394;
FT                   KEGG: tdn:Suden_1756 iojap-related protein; PFAM:
FT                   Iojap-related protein; SPTR: Iojap-related protein;
FT                   TIGRFAM: iojap-like protein; PFAM: Domain of unknown
FT                   function DUF143; TIGRFAM: iojap-like ribosome-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32952"
FT                   /db_xref="GOA:E4TYH5"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH5"
FT                   /protein_id="ADR32952.1"
FT                   /translation="MNPRIEKISAILDQNKAEAIEVFDLQGGDYFADYVVIASSLGERH
FT                   TLALLDHLKKGLKPEEQFLYVDESGDWVAIDLGDILVHILTPQYRVKYDLESFLGEIAA
FT                   RKNKA"
     MNPRIEKISA ILDQNKAEAI EVFDLQGGDY FADYVVIASS LGERHTLALL DHLKKGLKPE        60
     EQFLYVDESG DWVAIDLGDI LVHILTPQYR VKYDLESFLG EIAARKNKA                   109
//

If you have problems or comments...

PBIL Back to PBIL home page