(data stored in ACNUC7421 zone)

EMBL: CP002355.PE285

CP002355.PE285       Location/Qualifiers
FT   CDS             complement(276984..277517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0286"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="COGs: COG1057 Nicotinic acid mononucleotide
FT                   adenylyltransferase; InterPro IPR005248: IPR004821:
FT                   IPR004820; KEGG: tdn:Suden_1755 nicotinate-nucleotide
FT                   adenylyltransferase; PFAM: cytidylyltransferase; PRIAM:
FT                   Nicotinate-nucleotide adenylyltransferase; SPTR: Probable
FT                   nicotinate-nucleotide adenylyltransferase; TIGRFAM:
FT                   nicotinate (nicotinamide) nucleotide adenylyltransferase;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   Cytidylyltransferase; TIGRFAM: nicotinate (nicotinamide)
FT                   nucleotide adenylyltransferase; cytidyltransferase-related
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32953"
FT                   /db_xref="GOA:E4TYH6"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH6"
FT                   /protein_id="ADR32953.1"
FT                   /translation="MKLALYGGSFDPPHAGHVAVVEEALRVLPIDRLIVVPASRNPFKP
FT                   SVTVDGAVRFEWLKEIFKPYERVVISDFEIAHDRSVYTIETVKHFAPFCDELYLIIGAD
FT                   NLEKLSHWHNFDELDAMVHWVVADRDGISIPENMIRLTTHVPISSTDFRSSYVTLGLDP
FT                   KIEQKIITYYKEHL"
     MKLALYGGSF DPPHAGHVAV VEEALRVLPI DRLIVVPASR NPFKPSVTVD GAVRFEWLKE        60
     IFKPYERVVI SDFEIAHDRS VYTIETVKHF APFCDELYLI IGADNLEKLS HWHNFDELDA       120
     MVHWVVADRD GISIPENMIR LTTHVPISST DFRSSYVTLG LDPKIEQKII TYYKEHL          177
//

If you have problems or comments...

PBIL Back to PBIL home page