(data stored in ACNUC7421 zone)

EMBL: CP002355.PE286

CP002355.PE286       Location/Qualifiers
FT   CDS             277599..278603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0287"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="COGs: COG0057 Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase;
FT                   InterProIPR020830: IPR020831: IPR006424: IPR020832: IPR
FT                   020828: IPR020829; KEGG: tdn:Suden_1754
FT                   glyceraldehyde-3-phosphate dehydrogenase; PFAM:
FT                   Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding
FT                   domain; Glyceraldehyde 3-phosphate dehydrogenase, catalytic
FT                   domain; PRIAM: Glyceraldehyde-3-phosphate dehydrogenase
FT                   (phosphorylating); SPTR: Glyceraldehyde-3-phosphate
FT                   dehydrogenase; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: Glyceraldehyde 3-phosphate
FT                   dehydrogenase, C-terminal domain; Glyceraldehyde
FT                   3-phosphate dehydrogenase, NAD binding domain; TIGRFAM:
FT                   glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32954"
FT                   /db_xref="GOA:E4TYH7"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH7"
FT                   /protein_id="ADR32954.1"
FT                   /translation="MALKIALNGFGRIGRCVTRLIAMRTDVELVAINDMASVEMMLYLL
FT                   QNDSVHGQFGIDAAIIGDDYLQIAGQKVRIFSEKNPENLDFASLGADVVFECSGLFLTG
FT                   ALTKHHLEKGVKKVILSAPTQDSAIPTFVLGVNEHLYAGENIISNASCTTNCLGPIAKI
FT                   LDETYGIEKGLMTTVHAYTNGQAIIDSAHGSDMRRSRAAALNMIPTTTGAAKAISLVLP
FT                   SLEGKLHGQSVRVPTADVSMVDLNVLISRSTSKEELSNLFKSYAEGSLKGILEVDERYR
FT                   VSQDFVGSPFSATVADDLIQVVDGNMVKIMAWYDNEWGYSNRLIEMALFITKQ"
     MALKIALNGF GRIGRCVTRL IAMRTDVELV AINDMASVEM MLYLLQNDSV HGQFGIDAAI        60
     IGDDYLQIAG QKVRIFSEKN PENLDFASLG ADVVFECSGL FLTGALTKHH LEKGVKKVIL       120
     SAPTQDSAIP TFVLGVNEHL YAGENIISNA SCTTNCLGPI AKILDETYGI EKGLMTTVHA       180
     YTNGQAIIDS AHGSDMRRSR AAALNMIPTT TGAAKAISLV LPSLEGKLHG QSVRVPTADV       240
     SMVDLNVLIS RSTSKEELSN LFKSYAEGSL KGILEVDERY RVSQDFVGSP FSATVADDLI       300
     QVVDGNMVKI MAWYDNEWGY SNRLIEMALF ITKQ                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page