(data stored in ACNUC7421 zone)

EMBL: CP002355.PE287

CP002355.PE287       Location/Qualifiers
FT   CDS             278649..279839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0288"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="COGs: COG0126 3-phosphoglycerate kinase; InterPro
FT                   IPR015911: IPR001576; KEGG: tdn:Suden_1753 phosphoglycerate
FT                   kinase; PFAM: phosphoglycerate kinase; PRIAM:
FT                   Phosphoglycerate kinase; SPTR: Phosphoglycerate kinase;
FT                   PFAM: Phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32955"
FT                   /db_xref="GOA:E4TYH8"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH8"
FT                   /protein_id="ADR32955.1"
FT                   /translation="MQLLGIKECDIHGKKVFIRCDFNVPMDDYGNITDDRRIRSALATI
FT                   NYCLDQKCAIILASHFGRPKGEPDEKYSLAPIARRLHQLLKIDVQVADDVVGESALKLA
FT                   HELKNGEVLLLENLRFEKGETKNDPDLSAALASMAEVYINDAFGVSHRAHASVEGITAH
FT                   FDNAHKAAGFLLQKEIQFFGTLLEHPVRPFAAIVGGSKVSGKLEALINLLPKVDKMLIG
FT                   GGMAFTFLKALGHDVGNSLVEDDLIPEALKIMEEAKRLGVKFYLPVDVVAAEKFAPDSA
FT                   SRLCSVQEIPSGWMGLDIGPATVRLYRQVLGDVQTILWNGPMGVYEMDRYARGSNKIAH
FT                   FVADSYATSVVGGGDTADLVQRVGLDEEITFISTGGGASLELLEGKILPGVKPLLK"
     MQLLGIKECD IHGKKVFIRC DFNVPMDDYG NITDDRRIRS ALATINYCLD QKCAIILASH        60
     FGRPKGEPDE KYSLAPIARR LHQLLKIDVQ VADDVVGESA LKLAHELKNG EVLLLENLRF       120
     EKGETKNDPD LSAALASMAE VYINDAFGVS HRAHASVEGI TAHFDNAHKA AGFLLQKEIQ       180
     FFGTLLEHPV RPFAAIVGGS KVSGKLEALI NLLPKVDKML IGGGMAFTFL KALGHDVGNS       240
     LVEDDLIPEA LKIMEEAKRL GVKFYLPVDV VAAEKFAPDS ASRLCSVQEI PSGWMGLDIG       300
     PATVRLYRQV LGDVQTILWN GPMGVYEMDR YARGSNKIAH FVADSYATSV VGGGDTADLV       360
     QRVGLDEEIT FISTGGGASL ELLEGKILPG VKPLLK                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page