(data stored in ACNUC7421 zone)

EMBL: CP002355.PE289

CP002355.PE289       Location/Qualifiers
FT   CDS             280576..281400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0290"
FT                   /product="Enoyl-(acyl-carrier-protein) reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /note="COGs: COG0623 Enoyl-(acyl-carrier-protein); InterPro
FT                   IPR002347: IPR002198; KEGG: tdn:Suden_1751 enoyl-(acyl
FT                   carrier protein) reductase; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR:
FT                   Enoyl-[acyl-carrier-protein] reductase (NADH); PFAM: short
FT                   chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32957"
FT                   /db_xref="GOA:E4TYI0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI0"
FT                   /protein_id="ADR32957.1"
FT                   /translation="MLMQGKKGLIVGLANDKSIAYGIAQALHKQGAQMAFTYLNEALQK
FT                   RVEPIAASFDNSPVYKLDVSDEADMEAIAAKVAADFGEIDFLVHSVAFAPKEALTEGFM
FT                   KTSKSAFQIAMDVSVYSLIDLTNRLESVLAPGASIITLSYLGGPKYIPNYNVMGVAKAA
FT                   LESTVRYMAVELGASKGQRVNAISAGPIKTLAASGIGDFKQILNWNESNAPLRKNVTIE
FT                   EVGNSAMYLLSDLSSGVSGEVHYVDAGYNIMGMAAVEKNAEGKSVFVWDANK"
     MLMQGKKGLI VGLANDKSIA YGIAQALHKQ GAQMAFTYLN EALQKRVEPI AASFDNSPVY        60
     KLDVSDEADM EAIAAKVAAD FGEIDFLVHS VAFAPKEALT EGFMKTSKSA FQIAMDVSVY       120
     SLIDLTNRLE SVLAPGASII TLSYLGGPKY IPNYNVMGVA KAALESTVRY MAVELGASKG       180
     QRVNAISAGP IKTLAASGIG DFKQILNWNE SNAPLRKNVT IEEVGNSAMY LLSDLSSGVS       240
     GEVHYVDAGY NIMGMAAVEK NAEGKSVFVW DANK                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page