(data stored in ACNUC7421 zone)

EMBL: CP002355.PE290

CP002355.PE290       Location/Qualifiers
FT   CDS             complement(281671..282210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpi:Rpic_4347 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32958"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI1"
FT                   /protein_id="ADR32958.1"
FT                   /translation="MRHSLSLSIALLILSGCAANHMGVTPSQNTNLQAVSPSTTAASEG
FT                   GIMQRSLDIWLKEEWNPMMANEPTVNTKQQSDGTVITTKTEPTKMSVTTQTSDGKTVQK
FT                   MTNATQITTTMKAPDGTVTTKTEVVPLDEDNTPFTLQKYADKWKSYLEKKEKMNEGKPK
FT                   EPSHIEKINGMPVIGK"
     MRHSLSLSIA LLILSGCAAN HMGVTPSQNT NLQAVSPSTT AASEGGIMQR SLDIWLKEEW        60
     NPMMANEPTV NTKQQSDGTV ITTKTEPTKM SVTTQTSDGK TVQKMTNATQ ITTTMKAPDG       120
     TVTTKTEVVP LDEDNTPFTL QKYADKWKSY LEKKEKMNEG KPKEPSHIEK INGMPVIGK        179
//

If you have problems or comments...

PBIL Back to PBIL home page