(data stored in ACNUC7421 zone)

EMBL: CP002355.PE291

CP002355.PE291       Location/Qualifiers
FT   CDS             282461..283801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1487 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32959"
FT                   /db_xref="GOA:E4TYI2"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI2"
FT                   /protein_id="ADR32959.1"
FT                   /translation="MKLVKMSLAAAVLLGASAFAIDNVKVSGDAKLYYNTNNADYLDGS
FT                   GNKQSGLFDKAASAADTALTLGVTGDLTKGVSFGVKGIAVSTLGLENNLVSNTWTGAHD
FT                   AKANGSSFGAQVDDQAWISEMWVAATLGKTTAKLGRMELDTPFAFSEKWSIATNTFDAA
FT                   VLINQDIPDTTLVGAWVGKGNGVNAIGAYSLNGVPSNTPAVGIDGIVGAGANFDTFASD
FT                   GAYAAALVNNSFKPLTFQAWYYNVVDVADTYWLQADIDCQLVKGVKIGAQYANMSPKGN
FT                   IESTLDGIGSNDNSSAYAFKLGYEGVQNLKVSAAYSKADSDGVLKIANVATNNLGAAQS
FT                   KLYTEAWWNYGYVGAPDARSWNVTAEYDAGLAKLGAYYTDVSIDDTNVVNQAVGGKDNV
FT                   DMKEIAVTATKSFGPLDATLAYISTDADDQNTGDRYDTVQAYLTLNF"
     MKLVKMSLAA AVLLGASAFA IDNVKVSGDA KLYYNTNNAD YLDGSGNKQS GLFDKAASAA        60
     DTALTLGVTG DLTKGVSFGV KGIAVSTLGL ENNLVSNTWT GAHDAKANGS SFGAQVDDQA       120
     WISEMWVAAT LGKTTAKLGR MELDTPFAFS EKWSIATNTF DAAVLINQDI PDTTLVGAWV       180
     GKGNGVNAIG AYSLNGVPSN TPAVGIDGIV GAGANFDTFA SDGAYAAALV NNSFKPLTFQ       240
     AWYYNVVDVA DTYWLQADID CQLVKGVKIG AQYANMSPKG NIESTLDGIG SNDNSSAYAF       300
     KLGYEGVQNL KVSAAYSKAD SDGVLKIANV ATNNLGAAQS KLYTEAWWNY GYVGAPDARS       360
     WNVTAEYDAG LAKLGAYYTD VSIDDTNVVN QAVGGKDNVD MKEIAVTATK SFGPLDATLA       420
     YISTDADDQN TGDRYDTVQA YLTLNF                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page