(data stored in ACNUC7421 zone)

EMBL: CP002355.PE293

CP002355.PE293       Location/Qualifiers
FT   CDS             complement(285115..286248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0294"
FT                   /product="NusA antitermination factor"
FT                   /note="COGs: COG0195 Transcription elongation factor;
FT                   InterPro IPR010213: IPR003029: IPR013735; KEGG:
FT                   tdn:Suden_1748 transcription elongation factor NusA; PFAM:
FT                   NusA domain-containing protein; SPTR: Transcription
FT                   termination factor NusA; TIGRFAM: transcription termination
FT                   factor NusA; PFAM: NusA N-terminal domain; TIGRFAM:
FT                   transcription termination factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32961"
FT                   /db_xref="GOA:E4TYI4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI4"
FT                   /protein_id="ADR32961.1"
FT                   /translation="MENILDIIESIANEKGLNPDRVQEAIKTSFIQTAKRIINPTFAFE
FT                   ADIDDRTKQVRLRQIITVVADDAPELEGEEAGAYMGITAALEIDDEAEIGDQLQMEHDI
FT                   ESYGRSAFATLHREIEFHIQRLVENELYDKYKSKINQIVSGRVTRVDSDQNTTIEIDEI
FT                   RAVLPMKSRIKGEKFKVGDVVSAIVRRVHVDKSNGISMELSRTAPKFLEELLALEVPEI
FT                   KDGIVVIEKCARIPGERAKIALYTNRPQIDPIGATVGVRGVRINAVSEELCGENIDCVE
FT                   YSSSPELFISRAMSPAIISAVVVTENEGEEKKAVVTLPSDQKSKAIGKSGINIRLASML
FT                   TGYTIELNEVGGSAQMGEKAQEEKKEGLSSLEALFGN"
     MENILDIIES IANEKGLNPD RVQEAIKTSF IQTAKRIINP TFAFEADIDD RTKQVRLRQI        60
     ITVVADDAPE LEGEEAGAYM GITAALEIDD EAEIGDQLQM EHDIESYGRS AFATLHREIE       120
     FHIQRLVENE LYDKYKSKIN QIVSGRVTRV DSDQNTTIEI DEIRAVLPMK SRIKGEKFKV       180
     GDVVSAIVRR VHVDKSNGIS MELSRTAPKF LEELLALEVP EIKDGIVVIE KCARIPGERA       240
     KIALYTNRPQ IDPIGATVGV RGVRINAVSE ELCGENIDCV EYSSSPELFI SRAMSPAIIS       300
     AVVVTENEGE EKKAVVTLPS DQKSKAIGKS GINIRLASML TGYTIELNEV GGSAQMGEKA       360
     QEEKKEGLSS LEALFGN                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page