(data stored in ACNUC7421 zone)

EMBL: CP002355.PE295

CP002355.PE295       Location/Qualifiers
FT   CDS             286778..288079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0296"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /note="COGs: COG0621 2-methylthioadenine synthetase;
FT                   InterProIPR020612: IPR006463: IPR005839: IPR002792: IPR
FT                   013848: IPR007197: IPR006638; KEGG: tdn:Suden_1746
FT                   (dimethylallyl)adenosine tRNA methylthiotransferase; PFAM:
FT                   protein of unknown function UPF0004; Radical SAM domain
FT                   protein; deoxyribonuclease/rho motif-related TRAM; SMART:
FT                   Elongator protein 3/MiaB/NifB; SPTR: tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; TIGRFAM: tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; RNA modification enzyme, MiaB
FT                   family; PFAM: TRAM domain; Radical SAM superfamily;
FT                   Uncharacterized protein family UPF0004; TIGRFAM:
FT                   tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme
FT                   MiaB; RNA modification enzyme, MiaB family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32963"
FT                   /db_xref="GOA:E4TYI6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI6"
FT                   /protein_id="ADR32963.1"
FT                   /translation="MSKKLFIETLGCAMNVRDSEHMIAELNAHEGYELTDDAASADLIL
FT                   INTCSVREKPVHKLFSELGVFNKLKKADAKIGVCGCTASHLGKEIIKRAPYVNFVLGAR
FT                   NVSKIADVLHRDRAVEVEIDYDESQFAFKDFRSSPYKAYINISIGCDKQCTFCIVPKTR
FT                   GDEISIPPDLIVAEVRKAVENGAKEVFLLGQNVNNYGRRFSDVNDKMNFTELLRRVSAV
FT                   EGLERIRFTSPHPFHMDDEFLEEFARNPKICKSMHMPLQSGSTDILKAMKRGYTKEWFL
FT                   NRARKLRELVPDVSISTDIIVAFPGESDADFEDTLDVMKEVRFEQVFSFKYSPRPLTEA
FT                   ESFTNVVDSELGSFRLSTLQAYQDTILDSISAGLLGKEYDVYFEELRSDGYVAGRSDNN
FT                   IMIKVKGSEEWLGKIARVKITEVSRSVQYGEIIA"
     MSKKLFIETL GCAMNVRDSE HMIAELNAHE GYELTDDAAS ADLILINTCS VREKPVHKLF        60
     SELGVFNKLK KADAKIGVCG CTASHLGKEI IKRAPYVNFV LGARNVSKIA DVLHRDRAVE       120
     VEIDYDESQF AFKDFRSSPY KAYINISIGC DKQCTFCIVP KTRGDEISIP PDLIVAEVRK       180
     AVENGAKEVF LLGQNVNNYG RRFSDVNDKM NFTELLRRVS AVEGLERIRF TSPHPFHMDD       240
     EFLEEFARNP KICKSMHMPL QSGSTDILKA MKRGYTKEWF LNRARKLREL VPDVSISTDI       300
     IVAFPGESDA DFEDTLDVMK EVRFEQVFSF KYSPRPLTEA ESFTNVVDSE LGSFRLSTLQ       360
     AYQDTILDSI SAGLLGKEYD VYFEELRSDG YVAGRSDNNI MIKVKGSEEW LGKIARVKIT       420
     EVSRSVQYGE IIA                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page