(data stored in ACNUC7421 zone)

EMBL: CP002355.PE296

CP002355.PE296       Location/Qualifiers
FT   CDS             288072..288695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0297"
FT                   /product="protein of unknown function DUF374"
FT                   /note="COGs: COG2121 conserved hypothetical protein;
FT                   InterPro IPR007172; KEGG: tdn:Suden_1745 hypothetical
FT                   protein; PFAM: protein of unknown function DUF374; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DUF374)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32964"
FT                   /db_xref="GOA:E4TYI7"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI7"
FT                   /protein_id="ADR32964.1"
FT                   /translation="MRKRFLRALALWLIPPIGTLLIRLIYLTNRKRFHLPMSIPNEPVI
FT                   FAFWHGDLLMQPYLYYQFRRNPKANVLISDHFDGQIIARIMRYFKLGTIHGSTTRGGAK
FT                   VLIQGLKSLSEGYDIGITPDGPKGPRHEMSDGVVVMAQKRNAKVIVYSCVPSTFWQLPS
FT                   WDRFTVPKPFGRLDFYASEPIDLGGLEMEAAKALIKAKLMEHVL"
     MRKRFLRALA LWLIPPIGTL LIRLIYLTNR KRFHLPMSIP NEPVIFAFWH GDLLMQPYLY        60
     YQFRRNPKAN VLISDHFDGQ IIARIMRYFK LGTIHGSTTR GGAKVLIQGL KSLSEGYDIG       120
     ITPDGPKGPR HEMSDGVVVM AQKRNAKVIV YSCVPSTFWQ LPSWDRFTVP KPFGRLDFYA       180
     SEPIDLGGLE MEAAKALIKA KLMEHVL                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page