(data stored in ACNUC7421 zone)

EMBL: CP002355.PE297

CP002355.PE297       Location/Qualifiers
FT   CDS             288702..289550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0298"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR004107: IPR002104; KEGG: tdn:Suden_1743 phage
FT                   integrase; PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; SPTR: Phage integrase; PFAM:
FT                   Phage integrase, N-terminal SAM-like domain; Phage
FT                   integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32965"
FT                   /db_xref="GOA:E4TYI8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI8"
FT                   /protein_id="ADR32965.1"
FT                   /translation="MQMNELYRQKEAFLKYLDTIRGYSPLTIRSYNDAIDEMLTFAEMD
FT                   ASSNLLSINLMPLRLKISSLKAKSIAAKLSAIRSFVKYLRSQGKTVELRGDESIKTPKT
FT                   LPKPITHEQILHALQYAEPQAALAITLLYTMGLRISELTHLRLSDISEGWSRIHGKGSK
FT                   ERDIPMMDNIRTMVQEYQKINPSREYVFELKGEKLSENSLRYTIIKAFAKVGLKVTPHQ
FT                   LRHTYATELLNNGARIADVSELLGHASMATTQIYTKLGNALKMEHYLQSHPLCQTHEDS
FT                   K"
     MQMNELYRQK EAFLKYLDTI RGYSPLTIRS YNDAIDEMLT FAEMDASSNL LSINLMPLRL        60
     KISSLKAKSI AAKLSAIRSF VKYLRSQGKT VELRGDESIK TPKTLPKPIT HEQILHALQY       120
     AEPQAALAIT LLYTMGLRIS ELTHLRLSDI SEGWSRIHGK GSKERDIPMM DNIRTMVQEY       180
     QKINPSREYV FELKGEKLSE NSLRYTIIKA FAKVGLKVTP HQLRHTYATE LLNNGARIAD       240
     VSELLGHASM ATTQIYTKLG NALKMEHYLQ SHPLCQTHED SK                          282
//

If you have problems or comments...

PBIL Back to PBIL home page