(data stored in ACNUC7421 zone)

EMBL: CP002355.PE298

CP002355.PE298       Location/Qualifiers
FT   CDS             289547..290584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1742 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32966"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI9"
FT                   /protein_id="ADR32966.1"
FT                   /translation="MIERFYRKIFVAIVQDGGAHDVRVVVQKKRKLLNKQSRKFEGKSA
FT                   LDEIRSYLGKYLDESPLHYVAVLNPAVKQGALPGCRNHLDEEMEEISGAKTLCQNEDWL
FT                   LYSSMRELDSLQTEYKSIGLDFIFSPFSVLEHFFKDKVHGGFALYALAQKDSFSVAFFE
FT                   DGKLEYAHHYPMQEKNTLTLEDESSTMGFAVGIKEEDEIDKGISLDDIESLDDLDILEE
FT                   LDDLSEIEDLDNLDEIVEFSEDEPTFEEKRIVFPRGSEIKQEMDMFNNDYRRFELIQRT
FT                   LARFYRGEHCNDRFVETIFIADAYGSGAELKQYLEEELFLNVSIRHIDVADEVIALAMA
FT                   EEEEL"
     MIERFYRKIF VAIVQDGGAH DVRVVVQKKR KLLNKQSRKF EGKSALDEIR SYLGKYLDES        60
     PLHYVAVLNP AVKQGALPGC RNHLDEEMEE ISGAKTLCQN EDWLLYSSMR ELDSLQTEYK       120
     SIGLDFIFSP FSVLEHFFKD KVHGGFALYA LAQKDSFSVA FFEDGKLEYA HHYPMQEKNT       180
     LTLEDESSTM GFAVGIKEED EIDKGISLDD IESLDDLDIL EELDDLSEIE DLDNLDEIVE       240
     FSEDEPTFEE KRIVFPRGSE IKQEMDMFNN DYRRFELIQR TLARFYRGEH CNDRFVETIF       300
     IADAYGSGAE LKQYLEEELF LNVSIRHIDV ADEVIALAMA EEEEL                       345
//

If you have problems or comments...

PBIL Back to PBIL home page