(data stored in ACNUC7421 zone)

EMBL: CP002355.PE299

CP002355.PE299       Location/Qualifiers
FT   CDS             290581..291105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1741 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32967"
FT                   /db_xref="GOA:E4TYJ0"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ0"
FT                   /protein_id="ADR32967.1"
FT                   /translation="MKYSFIAPRKKRLISGELRLVLFFFAVTIAMLVGTYVFLEYKTYD
FT                   FVNERKNVALKEKSIKRSVEVMQEQIKTIEKEAKIVEQVTTSNAVMKESIRNLFDLVPE
FT                   DITLSRAELEEKSLILYGMTPNKDTYEYMLHAPLRSIFNRSYTSFYPIENGWYRFVSSN
FT                   YLDDETVEEIK"
     MKYSFIAPRK KRLISGELRL VLFFFAVTIA MLVGTYVFLE YKTYDFVNER KNVALKEKSI        60
     KRSVEVMQEQ IKTIEKEAKI VEQVTTSNAV MKESIRNLFD LVPEDITLSR AELEEKSLIL       120
     YGMTPNKDTY EYMLHAPLRS IFNRSYTSFY PIENGWYRFV SSNYLDDETV EEIK             174
//

If you have problems or comments...

PBIL Back to PBIL home page