(data stored in ACNUC7421 zone)

EMBL: CP002355.PE3

CP002355.PE3         Location/Qualifiers
FT   CDS             2894..5209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0003"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.6.2.3"
FT                   /note="COGs: COG0187 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) B subunit;
FT                   InterProIPR018522: IPR011557: IPR001241: IPR000565: IPR
FT                   003594: IPR013506: IPR006171: IPR002288; KEGG:
FT                   tdn:Suden_0003 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein; SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; SPTR: DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: Toprim domain; Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; DNA gyrase
FT                   B; DNA gyrase B subunit, carboxyl terminus; TIGRFAM: DNA
FT                   gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32671"
FT                   /db_xref="GOA:E4TW55"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW55"
FT                   /protein_id="ADR32671.1"
FT                   /translation="MENYGASNIKVLKGLEAVRKRPGMYIGDTGHRGLHHLIYEVVDNS
FT                   IDEAMAGHCDTITVTLTKNGTAIVSDNGRGIPTDMHPTEGISAATVVLTVLHAGGKFDK
FT                   DTYKVSGGLHGVGVSVVNALSSDLKMTIHREGQSFEQNFKCGIPQEPLAITGTTRKRGT
FT                   TIEFFPDPSIFTETIIFDYDYLAKRFRELAYLNPRITIIFKDERNGASNTYHFEGGISQ
FT                   FVTDVNKKTVVASPFAFSEKIEDIEMDIAIMYNDSYDDKTFTFVNNINTPNGGTHEAGF
FT                   RAGLTRVISNYNKQNGNAKEKDVPLTGEDVSEGLICVVSVRVPEPQFEGQTKGKLGNTY
FT                   VRPLVQKVTYEKLTKYFEENPLQAKAIVQKALMAARGREAAKKARELTRRKDAMTVGTL
FT                   PGKLADCQSKDPAISELYLVEGDSAGGSAKQGRDRVFQAILPLKGKILNVEKARLDKIL
FT                   KSEEITNMITALGCGIGEEFNEEKLRYHKIIIMTDADVDGSHIQTLLLTFFFRYLPKIV
FT                   ENGYLYLAQPPLYRYKKGKKEIYFKDDRVMNAFLIENGIEALEAENLNVGVNDLVSFFK
FT                   MVDHYRSTLDALERRYALVELIRYFIENPDLISLPLTEMYTKVEAFLTAQGNNILSKSV
FT                   SDEDMHLFVQTKEGLEELHINDELFASPHFAEANYIFQKIQDWNLPLEGDLLELLTQIT
FT                   DYAKKGSYIQRYKGLGEMNPEQLWETTMTPENRVLLRITIEDAETAGESFNLFMGDDVE
FT                   PRRNYIETHAKDVKHLDI"
     MENYGASNIK VLKGLEAVRK RPGMYIGDTG HRGLHHLIYE VVDNSIDEAM AGHCDTITVT        60
     LTKNGTAIVS DNGRGIPTDM HPTEGISAAT VVLTVLHAGG KFDKDTYKVS GGLHGVGVSV       120
     VNALSSDLKM TIHREGQSFE QNFKCGIPQE PLAITGTTRK RGTTIEFFPD PSIFTETIIF       180
     DYDYLAKRFR ELAYLNPRIT IIFKDERNGA SNTYHFEGGI SQFVTDVNKK TVVASPFAFS       240
     EKIEDIEMDI AIMYNDSYDD KTFTFVNNIN TPNGGTHEAG FRAGLTRVIS NYNKQNGNAK       300
     EKDVPLTGED VSEGLICVVS VRVPEPQFEG QTKGKLGNTY VRPLVQKVTY EKLTKYFEEN       360
     PLQAKAIVQK ALMAARGREA AKKARELTRR KDAMTVGTLP GKLADCQSKD PAISELYLVE       420
     GDSAGGSAKQ GRDRVFQAIL PLKGKILNVE KARLDKILKS EEITNMITAL GCGIGEEFNE       480
     EKLRYHKIII MTDADVDGSH IQTLLLTFFF RYLPKIVENG YLYLAQPPLY RYKKGKKEIY       540
     FKDDRVMNAF LIENGIEALE AENLNVGVND LVSFFKMVDH YRSTLDALER RYALVELIRY       600
     FIENPDLISL PLTEMYTKVE AFLTAQGNNI LSKSVSDEDM HLFVQTKEGL EELHINDELF       660
     ASPHFAEANY IFQKIQDWNL PLEGDLLELL TQITDYAKKG SYIQRYKGLG EMNPEQLWET       720
     TMTPENRVLL RITIEDAETA GESFNLFMGD DVEPRRNYIE THAKDVKHLD I                771
//

If you have problems or comments...

PBIL Back to PBIL home page