(data stored in ACNUC7421 zone)

EMBL: CP002355.PE30

CP002355.PE30        Location/Qualifiers
FT   CDS             complement(31179..32138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0030"
FT                   /product="transport system permease protein"
FT                   /note="COGs: COG0609 ABC-type Fe3+-siderophore transport
FT                   system permease component; InterPro IPR000522; KEGG:
FT                   ant:Arnit_1846 transport system permease; PFAM: transport
FT                   system permease protein; SPTR: Transport system permease
FT                   protein; PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32698"
FT                   /db_xref="GOA:E4TW82"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW82"
FT                   /protein_id="ADR32698.1"
FT                   /translation="MMKYVSFVLALAVLVIAPFFGEIAVDVQEIFNPESSSSMLFWEIR
FT                   FPRVIVAFCSGAILSLAGLVFQSIFRNPLTTPFTLGVASGATLGTALAIVFLGGLLFWQ
FT                   YALSFIGALLTVIVLFLLSRSLKSAQTLSLLLVGIALSFFYSAALMVLYYLSDFEQSYS
FT                   IVRFTMGSLNIVGFDTAYPIVIASLLFLFAIHWQRQPLRLLLTSLDFAFLKGLHVTRLV
FT                   MTLLLITSMAVAVCVSVVGPIGFVGLIVPHIIKLLYRSSSDTLIFPTFFYGGIFLVACD
FT                   LIARNLGAASDIPIGVVTSFLGGPFFIYLILHRHKGSR"
     MMKYVSFVLA LAVLVIAPFF GEIAVDVQEI FNPESSSSML FWEIRFPRVI VAFCSGAILS        60
     LAGLVFQSIF RNPLTTPFTL GVASGATLGT ALAIVFLGGL LFWQYALSFI GALLTVIVLF       120
     LLSRSLKSAQ TLSLLLVGIA LSFFYSAALM VLYYLSDFEQ SYSIVRFTMG SLNIVGFDTA       180
     YPIVIASLLF LFAIHWQRQP LRLLLTSLDF AFLKGLHVTR LVMTLLLITS MAVAVCVSVV       240
     GPIGFVGLIV PHIIKLLYRS SSDTLIFPTF FYGGIFLVAC DLIARNLGAA SDIPIGVVTS       300
     FLGGPFFIYL ILHRHKGSR                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page