(data stored in ACNUC7421 zone)

EMBL: CP002355.PE300

CP002355.PE300       Location/Qualifiers
FT   CDS             291102..291617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1740 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32968"
FT                   /db_xref="GOA:E4TYJ1"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ1"
FT                   /protein_id="ADR32968.1"
FT                   /translation="MKRQTLLVVILSLFLLIGVIAFSFLLLIPKGKEYRSLRLESKKEF
FT                   QQLELAQNRFDNTNNRLKDLQAQNRHTIGAFEKTFDPGRFERLYKKEFTDLYLTEVTTK
FT                   DSNGTFRVYEVNATSKITSPQSFYNFLDNINKSEWVIGVNFPIHFERDGDEIRSSFTMK
FT                   VHNKKEEK"
     MKRQTLLVVI LSLFLLIGVI AFSFLLLIPK GKEYRSLRLE SKKEFQQLEL AQNRFDNTNN        60
     RLKDLQAQNR HTIGAFEKTF DPGRFERLYK KEFTDLYLTE VTTKDSNGTF RVYEVNATSK       120
     ITSPQSFYNF LDNINKSEWV IGVNFPIHFE RDGDEIRSSF TMKVHNKKEE K                171
//

If you have problems or comments...

PBIL Back to PBIL home page