(data stored in ACNUC7421 zone)

EMBL: CP002355.PE302

CP002355.PE302       Location/Qualifiers
FT   CDS             complement(292374..292763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0303"
FT                   /product="protein of unknown function DUF180"
FT                   /note="COGs: COG1699 conserved hypothetical protein;
FT                   InterPro IPR003775; KEGG: hhe:HH0843 flagellar assembly
FT                   protein FliW; PFAM: protein of unknown function DUF180;
FT                   SPTR: Flagellar assembly factor fliW 1; PFAM: FliW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32970"
FT                   /db_xref="GOA:E4TYJ3"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ3"
FT                   /protein_id="ADR32970.1"
FT                   /translation="MQFDLKLPLLGFETVSKMELQKIDEIFFRLESIGEGPSFTLISPF
FT                   ALREYSFDIPSSLQALMGITPESNLLIYNIMILQTPIEKSTINFVAPLIFNTDNQTMAQ
FT                   IIVDNRSDFGIAEPIKNYLKSSTDE"
     MQFDLKLPLL GFETVSKMEL QKIDEIFFRL ESIGEGPSFT LISPFALREY SFDIPSSLQA        60
     LMGITPESNL LIYNIMILQT PIEKSTINFV APLIFNTDNQ TMAQIIVDNR SDFGIAEPIK       120
     NYLKSSTDE                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page