(data stored in ACNUC7421 zone)

EMBL: CP002355.PE303

CP002355.PE303       Location/Qualifiers
FT   CDS             292897..293673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0304"
FT                   /product="outer membrane assembly lipoprotein YfiO"
FT                   /note="COGs: COG4105 DNA uptake lipoprotein; InterPro
FT                   IPR017689; KEGG: tdn:Suden_0413 DNA uptake
FT                   lipoprotein-like; SPTR: DNA uptake lipoprotein-like
FT                   protein; TIGRFAM: outer membrane assembly lipoprotein YfiO;
FT                   TIGRFAM: outer membrane assembly lipoprotein YfiO"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32971"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ4"
FT                   /protein_id="ADR32971.1"
FT                   /translation="MIRTWLIAITTLILLTGCGSKDLEEFNKPAEYWYEKMVTAVSNGN
FT                   LERADSYFSSLQSEHISSPFLSEATMIMAQAHMAHEEYLLSEHFLDEYIRRYATPEGRE
FT                   YAEFLKIKAKFLALPNPGRDQGLIDETLNSVETFKRSYPNSMYLPLVHSMETQLQLARG
FT                   VLNEQIAELYERLGKPKAAGSYRTIAPVTWIDSKNIVRAEVPWYREMFEGDGTSSWYAF
FT                   MIPKTRSVVSMDDNESTASPKKQDNGSWYDFLIPHF"
     MIRTWLIAIT TLILLTGCGS KDLEEFNKPA EYWYEKMVTA VSNGNLERAD SYFSSLQSEH        60
     ISSPFLSEAT MIMAQAHMAH EEYLLSEHFL DEYIRRYATP EGREYAEFLK IKAKFLALPN       120
     PGRDQGLIDE TLNSVETFKR SYPNSMYLPL VHSMETQLQL ARGVLNEQIA ELYERLGKPK       180
     AAGSYRTIAP VTWIDSKNIV RAEVPWYREM FEGDGTSSWY AFMIPKTRSV VSMDDNESTA       240
     SPKKQDNGSW YDFLIPHF                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page