(data stored in ACNUC7421 zone)

EMBL: CP002355.PE304

CP002355.PE304       Location/Qualifiers
FT   CDS             293717..296140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0305"
FT                   /product="ATP-dependent proteinase"
FT                   /EC_number="3.4.21.53"
FT                   /note="COGs: COG0466 ATP-dependent Lon protease;
FT                   InterProIPR004815: IPR003111: IPR003959: IPR001984: IPR
FT                   008268: IPR003593; KEGG: tdn:Suden_0414 peptidase S16,
FT                   ATP-dependent protease La; PFAM: AAA ATPase central domain
FT                   protein; peptidase S16 lon domain protein; PRIAM:
FT                   Endopeptidase La; SMART: peptidase S16 lon domain protein;
FT                   AAA ATPase; SPTR: ATP-dependent protease La; TIGRFAM:
FT                   ATP-dependent protease La; PFAM: ATP-dependent protease La
FT                   (LON) domain; ATPase family associated with various
FT                   cellular activities (AAA); Lon protease (S16) C-terminal
FT                   proteolytic domain; TIGRFAM: ATP-dependent protease La"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32972"
FT                   /db_xref="GOA:E4TYJ5"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ5"
FT                   /protein_id="ADR32972.1"
FT                   /translation="MQLSNYSSFPTNLPVIAEDELFLYPFMISPLFLNDEKNIAAAAEA
FT                   IENNSLVIVCPVKPEHEGEREGDSIYDAGVIGSIMRKVVLPDGRIKVLFQGLARGHITE
FT                   MIHENPLRAHVDLIQSTSVNELKMDAILEVLREKVRALSQVSNYFPPDLLRTIEENHEY
FT                   NRIVDLICSSIKIKKENAYQLFIERDPEKRFLMLIDELIEETEANKLQKEIRSKVHSRI
FT                   EKVNKEYFLKEQLKQIQKELGTDTHRDEEIEEFRKKLEAKKDKMHADAYKEINKQLERF
FT                   ARMHPDSADAGMIQTYLEWVLEIPYGEEAKKALNIHDVENQLNKDHFSLKKPKERILEF
FT                   FSVKELLELRGIADKEGRGAILCFAGPPGVGKTSLANSIATALKRPLVRIALGGLEDVN
FT                   ELRGHRRTYIGAMPGRIVQGVIEAKKMNPVIVLDEIDKVAKSHRGDPTAVLLEILDPEQ
FT                   NTHFRDYYLNFNLDLSKAIFIATANDVGQIPGPLRDRMEFISVSSYTPQEKFQIAKQYL
FT                   IPQELKKHGLKTSELSISKTALAEVIEKHTREAGVRNLRRRVADIVRKAAKKILEEPTT
FT                   QKVTVSLKNLKEFLEKTIFEIDRTDHVDRIGVVNGLAWTAVGGDVLKIEAIRINGKGVL
FT                   QLTGSLGDVMKESARIALSVVKTLIDEGKISVDHSIIPLSPAERESDVPVDASEVYKRF
FT                   DLHVHVPDGATPKDGPSAGIAMSTVIASILTNKKVRADIAMTGEVSLTGNVLPIGGLKE
FT                   KLIAAHRAGMKLALIPQKNYDRDLADIPDEVKGALEIVGVSRIEEVLERLLIDA"
     MQLSNYSSFP TNLPVIAEDE LFLYPFMISP LFLNDEKNIA AAAEAIENNS LVIVCPVKPE        60
     HEGEREGDSI YDAGVIGSIM RKVVLPDGRI KVLFQGLARG HITEMIHENP LRAHVDLIQS       120
     TSVNELKMDA ILEVLREKVR ALSQVSNYFP PDLLRTIEEN HEYNRIVDLI CSSIKIKKEN       180
     AYQLFIERDP EKRFLMLIDE LIEETEANKL QKEIRSKVHS RIEKVNKEYF LKEQLKQIQK       240
     ELGTDTHRDE EIEEFRKKLE AKKDKMHADA YKEINKQLER FARMHPDSAD AGMIQTYLEW       300
     VLEIPYGEEA KKALNIHDVE NQLNKDHFSL KKPKERILEF FSVKELLELR GIADKEGRGA       360
     ILCFAGPPGV GKTSLANSIA TALKRPLVRI ALGGLEDVNE LRGHRRTYIG AMPGRIVQGV       420
     IEAKKMNPVI VLDEIDKVAK SHRGDPTAVL LEILDPEQNT HFRDYYLNFN LDLSKAIFIA       480
     TANDVGQIPG PLRDRMEFIS VSSYTPQEKF QIAKQYLIPQ ELKKHGLKTS ELSISKTALA       540
     EVIEKHTREA GVRNLRRRVA DIVRKAAKKI LEEPTTQKVT VSLKNLKEFL EKTIFEIDRT       600
     DHVDRIGVVN GLAWTAVGGD VLKIEAIRIN GKGVLQLTGS LGDVMKESAR IALSVVKTLI       660
     DEGKISVDHS IIPLSPAERE SDVPVDASEV YKRFDLHVHV PDGATPKDGP SAGIAMSTVI       720
     ASILTNKKVR ADIAMTGEVS LTGNVLPIGG LKEKLIAAHR AGMKLALIPQ KNYDRDLADI       780
     PDEVKGALEI VGVSRIEEVL ERLLIDA                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page