(data stored in ACNUC7421 zone)

EMBL: CP002355.PE305

CP002355.PE305       Location/Qualifiers
FT   CDS             complement(296094..297110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0306"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="COGs: COG0037 ATPase of the PP-loop superfamily
FT                   protein implicated in cell cycle control; InterPro
FT                   IPR012795: IPR011063; KEGG: tdn:Suden_1738
FT                   tRNA(Ile)-lysidine synthetase-like; PFAM: PP-loop domain
FT                   protein; SPTR: tRNA(Ile)-lysidine synthetase-like protein;
FT                   TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM: PP-loop
FT                   family; TIGRFAM: tRNA(Ile)-lysidine synthetase, N-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32973"
FT                   /db_xref="GOA:E4TYJ6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ6"
FT                   /protein_id="ADR32973.1"
FT                   /translation="MSKLLHLDRLREGRVLLAFSGGVDSTALFHLLLENNIAFDIAHVN
FT                   YHTRETSDAEEKNAERLAARHSLQCYAHSCRLGGINFEHRAREERYRFFGYLMKKHGYT
FT                   YLLTAHQLNDRLEWLMMQICRGSGLPEMLGIRSHDSRDGIEILRPLLEWDRDSIEAYLH
FT                   ERKIPHHIDESNADERYTRNFFRHRYSTPIMRDYRDAIRRSFRYLEEDSESLIESMDFK
FT                   TVNEFAYAENPTNIRSLLYGIDRYFKSRSYLLSKHDKEALKGGGDHIIGRRFIVSIEMK
FT                   YTFVAPYEANVVMDKGFKEECRKLKIATKLRGYLFGVPEAMRVMRQLKGAQELLRSD"
     MSKLLHLDRL REGRVLLAFS GGVDSTALFH LLLENNIAFD IAHVNYHTRE TSDAEEKNAE        60
     RLAARHSLQC YAHSCRLGGI NFEHRAREER YRFFGYLMKK HGYTYLLTAH QLNDRLEWLM       120
     MQICRGSGLP EMLGIRSHDS RDGIEILRPL LEWDRDSIEA YLHERKIPHH IDESNADERY       180
     TRNFFRHRYS TPIMRDYRDA IRRSFRYLEE DSESLIESMD FKTVNEFAYA ENPTNIRSLL       240
     YGIDRYFKSR SYLLSKHDKE ALKGGGDHII GRRFIVSIEM KYTFVAPYEA NVVMDKGFKE       300
     ECRKLKIATK LRGYLFGVPE AMRVMRQLKG AQELLRSD                               338
//

If you have problems or comments...

PBIL Back to PBIL home page