(data stored in ACNUC7421 zone)

EMBL: CP002355.PE306

CP002355.PE306       Location/Qualifiers
FT   CDS             complement(297103..298419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0307"
FT                   /product="SSU ribosomal protein S12P methylthiotransferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="COGs: COG0621 2-methylthioadenine synthetase;
FT                   InterProIPR005839: IPR005840: IPR013848: IPR007197: IPR
FT                   020612: IPR006638; KEGG: tdn:Suden_1737 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0004; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   SPTR: MiaB-like tRNA modifying enzyme YliG, TIGR01125;
FT                   TIGRFAM: MiaB-like tRNA modifying enzyme YliG; RNA
FT                   modification enzyme, MiaB family; PFAM: Radical SAM
FT                   superfamily; Uncharacterized protein family UPF0004;
FT                   TIGRFAM: MiaB-like tRNA modifying enzyme YliG, TIGR01125;
FT                   RNA modification enzyme, MiaB family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32974"
FT                   /db_xref="GOA:E4TYJ7"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ7"
FT                   /protein_id="ADR32974.1"
FT                   /translation="MSKKLHIVSLGCTKNLVDTEVMLGRLKDFEMTDASGEADVIIVNT
FT                   CGFIDAAKQESLNTIFNLDAGRKKDSVLVMAGCLSERYKEELSKELSEVDIFTGVGDYD
FT                   KIDELLAAKQSRFTPEVYLIDGAERVVTGSTYHAYIKLSEGCNQQCSFCAIPSFKGKLN
FT                   SRNLESIAHEVETLVAKGYYDFSFVSQDSSSYLRDQNIQDGLIHLIKRIELIDGVKSAR
FT                   ILYLYPSTTSLKLIKAIGDSKVFHNYFDMPIQHINDEMLKIMKRGFGKAKTLELLGAMK
FT                   ALPNAFIRTSFIVGHPQETEAMFEEMAEFSATFGFDRLNVFSYSDEEGTSAYTMEEKIP
FT                   SKTINARAKKLGKIASDVELSSLQKLVGTEITLVIDGESDEHEFLLSARALNWAPDVDG
FT                   EIYVNDREIEGELAFGKMYRARITELAEKRPLATVTGNV"
     MSKKLHIVSL GCTKNLVDTE VMLGRLKDFE MTDASGEADV IIVNTCGFID AAKQESLNTI        60
     FNLDAGRKKD SVLVMAGCLS ERYKEELSKE LSEVDIFTGV GDYDKIDELL AAKQSRFTPE       120
     VYLIDGAERV VTGSTYHAYI KLSEGCNQQC SFCAIPSFKG KLNSRNLESI AHEVETLVAK       180
     GYYDFSFVSQ DSSSYLRDQN IQDGLIHLIK RIELIDGVKS ARILYLYPST TSLKLIKAIG       240
     DSKVFHNYFD MPIQHINDEM LKIMKRGFGK AKTLELLGAM KALPNAFIRT SFIVGHPQET       300
     EAMFEEMAEF SATFGFDRLN VFSYSDEEGT SAYTMEEKIP SKTINARAKK LGKIASDVEL       360
     SSLQKLVGTE ITLVIDGESD EHEFLLSARA LNWAPDVDGE IYVNDREIEG ELAFGKMYRA       420
     RITELAEKRP LATVTGNV                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page