(data stored in ACNUC7421 zone)

EMBL: CP002355.PE308

CP002355.PE308       Location/Qualifiers
FT   CDS             299410..300012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0309"
FT                   /product="Ferric reductase domain protein transmembrane
FT                   component domain"
FT                   /note="COGs: COG2717 membrane protein; InterPro IPR013130;
FT                   KEGG: abu:Abu_0562 hypothetical protein; PFAM: Ferric
FT                   reductase domain protein transmembrane component domain;
FT                   SPTR: Conserved hypothetical membrane protein; PFAM: Ferric
FT                   reductase like transmembrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32976"
FT                   /db_xref="GOA:E4TYJ9"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ9"
FT                   /protein_id="ADR32976.1"
FT                   /translation="MRIIIWIGALLPIVFALFRFSAAFHPVWLNDILLFIEGYVHLSLT
FT                   KFPNDPLKFLINLSGESALWLLALSLTITPLRSYLKINLFSYRRLLGLFAFFYALIHAL
FT                   LFIGIDQQFDFDGLIHEVTTKPFIAFGMGAFLILLLMALTSTKKLFSNFKGWHRLVYIA
FT                   VVLIVVHYLMSHKTITWDNLSTAGVLIFLLVLRLIKR"
     MRIIIWIGAL LPIVFALFRF SAAFHPVWLN DILLFIEGYV HLSLTKFPND PLKFLINLSG        60
     ESALWLLALS LTITPLRSYL KINLFSYRRL LGLFAFFYAL IHALLFIGID QQFDFDGLIH       120
     EVTTKPFIAF GMGAFLILLL MALTSTKKLF SNFKGWHRLV YIAVVLIVVH YLMSHKTITW       180
     DNLSTAGVLI FLLVLRLIKR                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page