(data stored in ACNUC7421 zone)

EMBL: CP002355.PE309

CP002355.PE309       Location/Qualifiers
FT   CDS             300009..301154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0310"
FT                   /product="HI0933 family protein"
FT                   /note="COGs: COG2081 flavoprotein; InterPro IPR004792:
FT                   IPR013027; KEGG: tdn:Suden_1736 HI0933-like protein; PFAM:
FT                   HI0933 family protein; SPTR: HI0933-like protein; PFAM:
FT                   HI0933-like protein; TIGRFAM: flavoprotein, HI0933 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32977"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK0"
FT                   /protein_id="ADR32977.1"
FT                   /translation="MKHYDVIILGAGASGLMCAAQLRQNSSLSIAIIEGNNRPALKLKA
FT                   SGGGKCNLTNVEVDETHFLGDERLVLSALSTFSQKKLLDYFKAGGLRPVIRKERYYFCP
FT                   KSSDEVISILLGKAAGTDLLLGHKILSVEGKNPFVVTTDKGKFQACRVVVATGGASYKE
FT                   LGASDIGLKIAQHYDIKTIPFSPALVGLTLQPKEFWMKELSGISFPARIHVAGKTLDED
FT                   LLFAHKGISGLVVLSASLYWHRGEIVIDFLPDFELNTLKYEKKSVSTAIPLPKRFMKAF
FT                   LEAVGLEDKACNRLDSQDWEKLIRIRQYAMAPSGTFGFSKAEACRGGVACEEIDPLTME
FT                   STKIKGLYFIGETVDVTGELGGYNFQWAFSSAVVCSISVML"
     MKHYDVIILG AGASGLMCAA QLRQNSSLSI AIIEGNNRPA LKLKASGGGK CNLTNVEVDE        60
     THFLGDERLV LSALSTFSQK KLLDYFKAGG LRPVIRKERY YFCPKSSDEV ISILLGKAAG       120
     TDLLLGHKIL SVEGKNPFVV TTDKGKFQAC RVVVATGGAS YKELGASDIG LKIAQHYDIK       180
     TIPFSPALVG LTLQPKEFWM KELSGISFPA RIHVAGKTLD EDLLFAHKGI SGLVVLSASL       240
     YWHRGEIVID FLPDFELNTL KYEKKSVSTA IPLPKRFMKA FLEAVGLEDK ACNRLDSQDW       300
     EKLIRIRQYA MAPSGTFGFS KAEACRGGVA CEEIDPLTME STKIKGLYFI GETVDVTGEL       360
     GGYNFQWAFS SAVVCSISVM L                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page