(data stored in ACNUC7421 zone)

EMBL: CP002355.PE31

CP002355.PE31        Location/Qualifiers
FT   CDS             complement(32122..32835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0031"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems ATPase components; InterPro IPR017871:
FT                   IPR003439: IPR003593; KEGG: ant:Arnit_1847 ABC
FT                   transporter-like protein; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: ABC transporter related protein;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32699"
FT                   /db_xref="GOA:E4TW83"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW83"
FT                   /protein_id="ADR32699.1"
FT                   /translation="MLHVADLTCQILKNVSFALEEGKNLTILGNNGSGKTTLARALCHL
FT                   IPSESVFWEGKKIGDIAHHLRSQTINYVPTSLEIYDEYLSVTDYLDLNFFESSNPQMRE
FT                   EILGVMEIEHLRDSPCQRLSSGESSLLLIAGAILHRAAYTILDEPTANLDQAKKVKIYR
FT                   LLKSGSYFQNKIIITHDLNLAYKLGYDILYLEEGEVRFFGSCSDFFDPTQLEGCFGSAV
FT                   QNIGGNFVVNYDEVR"
     MLHVADLTCQ ILKNVSFALE EGKNLTILGN NGSGKTTLAR ALCHLIPSES VFWEGKKIGD        60
     IAHHLRSQTI NYVPTSLEIY DEYLSVTDYL DLNFFESSNP QMREEILGVM EIEHLRDSPC       120
     QRLSSGESSL LLIAGAILHR AAYTILDEPT ANLDQAKKVK IYRLLKSGSY FQNKIIITHD       180
     LNLAYKLGYD ILYLEEGEVR FFGSCSDFFD PTQLEGCFGS AVQNIGGNFV VNYDEVR          237
//

If you have problems or comments...

PBIL Back to PBIL home page