(data stored in ACNUC7421 zone)

EMBL: CP002355.PE310

CP002355.PE310       Location/Qualifiers
FT   CDS             301190..302419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0311"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG1252 NADH dehydrogenase FAD-containing
FT                   subunit; InterPro IPR013027: IPR000103; KEGG:
FT                   tdn:Suden_1213 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; PFAM:
FT                   Pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32978"
FT                   /db_xref="GOA:E4TYK1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK1"
FT                   /protein_id="ADR32978.1"
FT                   /translation="MKRQRVVIVGGGYAGVKALQTLAPSGQCDIVLIDQHPYHYLQTEA
FT                   YELIANECSMTRVTIDLVALCLSYGEHVTFIKDTIREIDFEHKCAGGQSSCHPYDYLLL
FT                   CSGSRTAFHTSVPGLREHSHGVKTLPSALAFKHQFEQRLYDRMESEGGWCSEPFNVVIG
FT                   GGGLSGVEIAAEMANYIRVFHLDNTLTCDNIHIFLIIPHENVLEGMEPYLIQKATERLT
FT                   RLGVKIIRHSRITSVEEHTLILNNEESICFDFMIFTGGIIASTLTTTIESEKNKKSQLI
FT                   IDEYLRVPLYEGVFAAGDIAEIRSTDGKILPPTAQIAEQSGTEAGKNILALIEGREMDR
FT                   VSMKIEGMMVALGGKYAAISLFGRIRFSGFAGYLIKTVIMRGYRYLLHRQCTKGMDGLS
FT                   KTKAQCHTGF"
     MKRQRVVIVG GGYAGVKALQ TLAPSGQCDI VLIDQHPYHY LQTEAYELIA NECSMTRVTI        60
     DLVALCLSYG EHVTFIKDTI REIDFEHKCA GGQSSCHPYD YLLLCSGSRT AFHTSVPGLR       120
     EHSHGVKTLP SALAFKHQFE QRLYDRMESE GGWCSEPFNV VIGGGGLSGV EIAAEMANYI       180
     RVFHLDNTLT CDNIHIFLII PHENVLEGME PYLIQKATER LTRLGVKIIR HSRITSVEEH       240
     TLILNNEESI CFDFMIFTGG IIASTLTTTI ESEKNKKSQL IIDEYLRVPL YEGVFAAGDI       300
     AEIRSTDGKI LPPTAQIAEQ SGTEAGKNIL ALIEGREMDR VSMKIEGMMV ALGGKYAAIS       360
     LFGRIRFSGF AGYLIKTVIM RGYRYLLHRQ CTKGMDGLSK TKAQCHTGF                   409
//

If you have problems or comments...

PBIL Back to PBIL home page