(data stored in ACNUC7421 zone)

EMBL: CP002355.PE314

CP002355.PE314       Location/Qualifiers
FT   CDS             304145..305191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0315"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1060 Thiamine biosynthesis protein ThiH;
FT                   InterPro IPR020050: IPR007197: IPR005244; KEGG:
FT                   tdn:Suden_0404 hypothetical protein; PFAM: Radical SAM
FT                   domain protein; SPTR: Putative uncharacterized protein;
FT                   PFAM: Radical SAM superfamily; TIGRFAM: radical SAM domain
FT                   protein, CofH subfamily; menaquinone biosynthesis protein,
FT                   SCO4550 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32982"
FT                   /db_xref="GOA:E4TYK5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK5"
FT                   /protein_id="ADR32982.1"
FT                   /translation="MRLSKEQALELIRHGDLKELGRMATARKKELHPDGITTFVVDRNI
FT                   NYTNVCWVDCKFCAFYRHGKDEDAYVLTFEEIDQKIEELLEIGGTQILFQGGVHPKLKI
FT                   EWYEDLVEHIHTKYPQITIHGFSSIELDFIAKVSHITIQECLSRLHAKGLASIPGAGAE
FT                   ILSDRVRDIIAPKKMDSLDWVDVHRQAHKLGIKSTATMMYGTVETDEEIIEHWNLIRNL
FT                   QDETGGFRAFIMWSFQGQNTQLMEEHPEIEKQSSNRYLRLLAVARLYLDNFPNIQSSWV
FT                   TQGPYIGQMALLFGANDLGSTMMEENVVRSAGAGFRMAKEEMIRLIRDIGETPAIRNTA
FT                   YEILEKFE"
     MRLSKEQALE LIRHGDLKEL GRMATARKKE LHPDGITTFV VDRNINYTNV CWVDCKFCAF        60
     YRHGKDEDAY VLTFEEIDQK IEELLEIGGT QILFQGGVHP KLKIEWYEDL VEHIHTKYPQ       120
     ITIHGFSSIE LDFIAKVSHI TIQECLSRLH AKGLASIPGA GAEILSDRVR DIIAPKKMDS       180
     LDWVDVHRQA HKLGIKSTAT MMYGTVETDE EIIEHWNLIR NLQDETGGFR AFIMWSFQGQ       240
     NTQLMEEHPE IEKQSSNRYL RLLAVARLYL DNFPNIQSSW VTQGPYIGQM ALLFGANDLG       300
     STMMEENVVR SAGAGFRMAK EEMIRLIRDI GETPAIRNTA YEILEKFE                    348
//

If you have problems or comments...

PBIL Back to PBIL home page