(data stored in ACNUC7421 zone)

EMBL: CP002355.PE315

CP002355.PE315       Location/Qualifiers
FT   CDS             305230..306576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0316"
FT                   /product="peptidase M16 domain protein"
FT                   /note="COGs: COG0612 Zn-dependent peptidase; InterPro
FT                   IPR011765: IPR007863; KEGG: tdn:Suden_0405 peptidase
FT                   M16-like; PFAM: peptidase M16 domain protein; SPTR:
FT                   Processing protease; PFAM: Peptidase M16 inactive domain;
FT                   Insulinase (Peptidase family M16)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32983"
FT                   /db_xref="GOA:E4TYK6"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK6"
FT                   /protein_id="ADR32983.1"
FT                   /translation="MGYANAEFSSAESPRTASRAFKKLFLILLLTGQALMASTLDFIDV
FT                   HGTKVPFIYEEDKRLPIVSMQIVFTHSGSIDEGKHFGLARLSAKMLNEGSLKRGSVGFA
FT                   DALDARAIQLSSNAGNETFVIELGSLKEEFDTGLSLLSEQLREPNFTAKSLEKVKTMAL
FT                   SDIARKEADFDTVASDELKAVLFEGTPMAVPNIGTKESIKAIKLSDVEAFKKEHLVLSN
FT                   ALIVMGGDISLNDAKHKAQSLLGILEKGKIGKERHYEPRKEPKESLLKRPQTEQAYLYF
FT                   GAPFAMKEGDPEFYKARVAMFILGSSGFGSRLMEEIRVKRGLAYSAYSRLSVAKTNTYF
FT                   SGYLQTKLESQDEAKKTVVEVIDTFVRDGVTQSELDQARKFLLGSEPLRVETLSQRLGR
FT                   TFSEYYQGKPLGYSLQELELIRTLTLDEVNDFIKRHGEIRDLSYAIVTK"
     MGYANAEFSS AESPRTASRA FKKLFLILLL TGQALMASTL DFIDVHGTKV PFIYEEDKRL        60
     PIVSMQIVFT HSGSIDEGKH FGLARLSAKM LNEGSLKRGS VGFADALDAR AIQLSSNAGN       120
     ETFVIELGSL KEEFDTGLSL LSEQLREPNF TAKSLEKVKT MALSDIARKE ADFDTVASDE       180
     LKAVLFEGTP MAVPNIGTKE SIKAIKLSDV EAFKKEHLVL SNALIVMGGD ISLNDAKHKA       240
     QSLLGILEKG KIGKERHYEP RKEPKESLLK RPQTEQAYLY FGAPFAMKEG DPEFYKARVA       300
     MFILGSSGFG SRLMEEIRVK RGLAYSAYSR LSVAKTNTYF SGYLQTKLES QDEAKKTVVE       360
     VIDTFVRDGV TQSELDQARK FLLGSEPLRV ETLSQRLGRT FSEYYQGKPL GYSLQELELI       420
     RTLTLDEVND FIKRHGEIRD LSYAIVTK                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page