(data stored in ACNUC7421 zone)

EMBL: CP002355.PE316

CP002355.PE316       Location/Qualifiers
FT   CDS             306557..308344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0317"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /note="COGs: COG1200 RecG-like helicase; InterPro
FT                   IPR011545: IPR001650: IPR014001: IPR014021; KEGG:
FT                   tdn:Suden_0406 ATP-dependent DNA helicase RecG; PFAM:
FT                   DEAD/DEAH box helicase domain protein; helicase domain
FT                   protein; SMART: DEAD-like helicase; helicase domain
FT                   protein; SPTR: ATP-dependent DNA helicase; PFAM: Helicase
FT                   conserved C-terminal domain; DEAD/DEAH box helicase;
FT                   TIGRFAM: ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32984"
FT                   /db_xref="GOA:E4TYK7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK7"
FT                   /protein_id="ADR32984.1"
FT                   /translation="MLLLPSEDAEKFHRLGVGSVTALSLIAPASFEDRRLSHELFHNAS
FT                   CVIDARVEHVVRTPKTLKITFFAHNLECVIEGVIFHPKPYMLHQFPKHERAFYIGKAQW
FT                   ELGKWTIVHPVKISAVGSLVPIYKTPLRADVMRRLILKYVSVENLIADGLPEKIASELY
FT                   GIHFPDIPKALSEVQTYALKFAELFEYMRRLRLKRRYHKTSYRALGDVKKWIKTLPFAL
FT                   TTDQQNAIADIGSDLRGENAARRMIVGDVGSGKTMVILASVILMHPYRSILMAPTTILA
FT                   AQLYEEAQKYLPNLRIALVTNATKKAPLEEFDFIIGTHALLHRPLPEAGLVMVDEQHRF
FT                   GTAQRHALTRLTDNDTSPHYLQFSATPIPRTQAMIDSAHIDVSLIVQTPFTKNIMTRII
FT                   HKSDFSALLDHIRSEIKQNHQVLIVYPLVEQSEMIDYQSIDEARGYWEKNFENVYVTHG
FT                   KDKEKEAVLMAFREKGAILLATTVVEVGISLPRLSTVVIVGAERLGLSTLHQLRGRVSR
FT                   TGLQGYCYLYTNKSGKNERLESFSRCNSGFEIAALDLKFRSSGDLLDGSIQSGKAFRWA
FT                   DIAEDEKIVREVKSWLDKN"
     MLLLPSEDAE KFHRLGVGSV TALSLIAPAS FEDRRLSHEL FHNASCVIDA RVEHVVRTPK        60
     TLKITFFAHN LECVIEGVIF HPKPYMLHQF PKHERAFYIG KAQWELGKWT IVHPVKISAV       120
     GSLVPIYKTP LRADVMRRLI LKYVSVENLI ADGLPEKIAS ELYGIHFPDI PKALSEVQTY       180
     ALKFAELFEY MRRLRLKRRY HKTSYRALGD VKKWIKTLPF ALTTDQQNAI ADIGSDLRGE       240
     NAARRMIVGD VGSGKTMVIL ASVILMHPYR SILMAPTTIL AAQLYEEAQK YLPNLRIALV       300
     TNATKKAPLE EFDFIIGTHA LLHRPLPEAG LVMVDEQHRF GTAQRHALTR LTDNDTSPHY       360
     LQFSATPIPR TQAMIDSAHI DVSLIVQTPF TKNIMTRIIH KSDFSALLDH IRSEIKQNHQ       420
     VLIVYPLVEQ SEMIDYQSID EARGYWEKNF ENVYVTHGKD KEKEAVLMAF REKGAILLAT       480
     TVVEVGISLP RLSTVVIVGA ERLGLSTLHQ LRGRVSRTGL QGYCYLYTNK SGKNERLESF       540
     SRCNSGFEIA ALDLKFRSSG DLLDGSIQSG KAFRWADIAE DEKIVREVKS WLDKN            595
//

If you have problems or comments...

PBIL Back to PBIL home page