(data stored in ACNUC7421 zone)

EMBL: CP002355.PE317

CP002355.PE317       Location/Qualifiers
FT   CDS             complement(308463..308999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0318"
FT                   /product="SSU ribosomal protein S30P;sigma 54 modulation
FT                   protein"
FT                   /note="COGs: COG1544 Ribosome-associated protein Y
FT                   (PSrp-1); InterPro IPR003489; KEGG: tdn:Suden_0407 sigma 54
FT                   modulation protein/ribosomal protein S30EA; PFAM: sigma 54
FT                   modulation protein/ribosomal protein S30EA; SPTR: SSU
FT                   ribosomal protein S30P / sigma 54 modulation protein;
FT                   TIGRFAM: ribosomal subunit interface protein; PFAM: Sigma
FT                   54 modulation protein / S30EA ribosomal protein; TIGRFAM:
FT                   ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32985"
FT                   /db_xref="GOA:E4TYK8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK8"
FT                   /protein_id="ADR32985.1"
FT                   /translation="MNISLVGRHIELSDAIKDHLMHSIDTLTKYHLDLISVNAVASANE
FT                   RKKGVTIEFTINVAGKNTIVITQRDDDLYAAIDIAIDRAQKALRRLHDRLSDHKNEGLN
FT                   EAKLAASNSIDLHAATEAMEDEIVPAEPILFKPQEVAEILEKLKESGKVFEVFYDIDGK
FT                   MRVLYKRSDGRFGLY"
     MNISLVGRHI ELSDAIKDHL MHSIDTLTKY HLDLISVNAV ASANERKKGV TIEFTINVAG        60
     KNTIVITQRD DDLYAAIDIA IDRAQKALRR LHDRLSDHKN EGLNEAKLAA SNSIDLHAAT       120
     EAMEDEIVPA EPILFKPQEV AEILEKLKES GKVFEVFYDI DGKMRVLYKR SDGRFGLY         178
//

If you have problems or comments...

PBIL Back to PBIL home page