(data stored in ACNUC7421 zone)

EMBL: CP002355.PE319

CP002355.PE319       Location/Qualifiers
FT   CDS             313031..313711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0320"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: nam:NAMH_1381 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32987"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL0"
FT                   /protein_id="ADR32987.1"
FT                   /translation="MRFGMTMIELVFAIVIIAISIVTIPSMMSVANNASKGVMIDEDVM
FT                   ERLGGWVLDKFQGRWDRNYLASGSAPLNISGMKDLNCSRTGGYRIGSDENTSSMKCNMA
FT                   ATPSVIPAVAGNNPGQADGNISRGIEQLNNGSETISITAANGTVYNVTATYSVAYVDSI
FT                   VTPLTGSNTQTATWILGSSTNMNPSSPSGNTGNTISHLKRVVTRFNNPDVNITLSFFKS
FT                   NKGN"
     MRFGMTMIEL VFAIVIIAIS IVTIPSMMSV ANNASKGVMI DEDVMERLGG WVLDKFQGRW        60
     DRNYLASGSA PLNISGMKDL NCSRTGGYRI GSDENTSSMK CNMAATPSVI PAVAGNNPGQ       120
     ADGNISRGIE QLNNGSETIS ITAANGTVYN VTATYSVAYV DSIVTPLTGS NTQTATWILG       180
     SSTNMNPSSP SGNTGNTISH LKRVVTRFNN PDVNITLSFF KSNKGN                      226
//

If you have problems or comments...

PBIL Back to PBIL home page