(data stored in ACNUC7421 zone)

EMBL: CP002355.PE32

CP002355.PE32        Location/Qualifiers
FT   CDS             complement(32819..33646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0032"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR002491; KEGG:
FT                   ant:Arnit_1848 periplasmic binding protein; PFAM:
FT                   periplasmic binding protein; SPTR: Periplasmic binding
FT                   protein; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32700"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW84"
FT                   /protein_id="ADR32700.1"
FT                   /translation="MLLKLWALLIVGMNLYGTERIIALSPAINETLYALGAGDQIIANT
FT                   EYCNYPVEAKNKPKVGGYFSPSLEKILSLNPTMVILQENNAPLAAKIQKMGIKTLIIKI
FT                   DTYPSIRRSIFTIGAVVHKEKRAEAIVSELDQKLRALRGIIRNQKILMVFGHNTDLSKS
FT                   IYVSGQNLYFDDLIRSSGNTNALQSRRKGQPVLNLENIIALNPDVIILLAPNTKERGLT
FT                   KEALIAPWRSLPINAAKREKIYVEDQPYSSNPSQRLGLFLDDMRGYLIDAARR"
     MLLKLWALLI VGMNLYGTER IIALSPAINE TLYALGAGDQ IIANTEYCNY PVEAKNKPKV        60
     GGYFSPSLEK ILSLNPTMVI LQENNAPLAA KIQKMGIKTL IIKIDTYPSI RRSIFTIGAV       120
     VHKEKRAEAI VSELDQKLRA LRGIIRNQKI LMVFGHNTDL SKSIYVSGQN LYFDDLIRSS       180
     GNTNALQSRR KGQPVLNLEN IIALNPDVII LLAPNTKERG LTKEALIAPW RSLPINAAKR       240
     EKIYVEDQPY SSNPSQRLGL FLDDMRGYLI DAARR                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page