(data stored in ACNUC7421 zone)

EMBL: CP002355.PE320

CP002355.PE320       Location/Qualifiers
FT   CDS             313712..314650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0321"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: sdl:Sdel_0855 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32988"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL1"
FT                   /protein_id="ADR32988.1"
FT                   /translation="MKSKRSAFTMIELLFVIVILGIVGGFALEAVRQYYDGIYRTQQYT
FT                   QRAAEADQILEQISKYFENGISSSIVNLDRGGAAAACYGPPVSGDNNDYTVAFIGVDED
FT                   SIRGIGGRPGWSEETVLGANNTLTALDANYTAADTIIQALSLNNGSDLSHSAIYDAGSV
FT                   DLDTCTRFNWNLLGGTGGYHRMDNVANPISSTVIQLNDDNNATDGHRKYLLRTGYAFRV
FT                   NNGNFTMYSNFRPWLGERYTAAQNQNILGQNVAHFYADYNATDFQNDSNVSDRGLVWRL
FT                   KVCIRGLDSSLNDTDARESQICRERRVHVRY"
     MKSKRSAFTM IELLFVIVIL GIVGGFALEA VRQYYDGIYR TQQYTQRAAE ADQILEQISK        60
     YFENGISSSI VNLDRGGAAA ACYGPPVSGD NNDYTVAFIG VDEDSIRGIG GRPGWSEETV       120
     LGANNTLTAL DANYTAADTI IQALSLNNGS DLSHSAIYDA GSVDLDTCTR FNWNLLGGTG       180
     GYHRMDNVAN PISSTVIQLN DDNNATDGHR KYLLRTGYAF RVNNGNFTMY SNFRPWLGER       240
     YTAAQNQNIL GQNVAHFYAD YNATDFQNDS NVSDRGLVWR LKVCIRGLDS SLNDTDARES       300
     QICRERRVHV RY                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page