(data stored in ACNUC7421 zone)

EMBL: CP002355.PE321

CP002355.PE321       Location/Qualifiers
FT   CDS             314637..315092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_0854 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32989"
FT                   /db_xref="GOA:E4TYL2"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL2"
FT                   /protein_id="ADR32989.1"
FT                   /translation="MYATKRSGFAMILAIVIVVLVALGGVLLLRSSATGSKSVGDNYLK
FT                   VQAELLADSATEFAVMRAQGFDHTGGNCLNNLNITVQDASGISAYDVNVSLAYSFRNPV
FT                   VVGFNDACTRLADNTGKDTMILLDVTVTDHNLSTEPIRVHKRTWQKL"
     MYATKRSGFA MILAIVIVVL VALGGVLLLR SSATGSKSVG DNYLKVQAEL LADSATEFAV        60
     MRAQGFDHTG GNCLNNLNIT VQDASGISAY DVNVSLAYSF RNPVVVGFND ACTRLADNTG       120
     KDTMILLDVT VTDHNLSTEP IRVHKRTWQK L                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page