(data stored in ACNUC7421 zone)

EMBL: CP002355.PE322

CP002355.PE322       Location/Qualifiers
FT   CDS             complement(315135..315512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0323"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG3437 Response regulator containing a
FT                   CheY-like receiver domain and an HD-GYP domain; InterPro
FT                   IPR001789; KEGG: tdn:Suden_0415 response regulator receiver
FT                   domain-containing protein; PFAM: response regulator
FT                   receiver; SMART: response regulator receiver; SPTR:
FT                   Response regulator receiver domain protein; PFAM: Response
FT                   regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32990"
FT                   /db_xref="GOA:E4TYL3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL3"
FT                   /protein_id="ADR32990.1"
FT                   /translation="MDEKKLKVLAVDDDLINLKLLKTMLMKTPNVSAVVEAKNGADAIG
FT                   ILKTQNDIDIILLDIIMPVMGGIEMLKVIRADESLRQLPVIVLTTDETKKGEALECGAN
FT                   GFLMKPVREKDVLTKIAQLAF"
     MDEKKLKVLA VDDDLINLKL LKTMLMKTPN VSAVVEAKNG ADAIGILKTQ NDIDIILLDI        60
     IMPVMGGIEM LKVIRADESL RQLPVIVLTT DETKKGEALE CGANGFLMKP VREKDVLTKI       120
     AQLAF                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page