(data stored in ACNUC7421 zone)

EMBL: CP002355.PE323

CP002355.PE323       Location/Qualifiers
FT   CDS             complement(315532..318798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0324"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR003661: IPR003594: IPR001789: IPR004358: IPR
FT                   005467; KEGG: tdn:Suden_0416 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; response regulator receiver; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; response regulator receiver; SPTR:
FT                   Nitrate and nitrite sensing family; PFAM: Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; Nitrate and
FT                   nitrite sensing; Response regulator receiver domain; His
FT                   Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32991"
FT                   /db_xref="GOA:E4TYL4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL4"
FT                   /protein_id="ADR32991.1"
FT                   /translation="MQLGLRNRLRLISLLPILILFTLASYYVYNAYISYKGAEELQIRL
FT                   EGNKQLNDLINNLSRERGMTVMYMGNASPATLKSLHAQRAIVDQKIGIYQEHLARLEHT
FT                   NGPEAAKAAALSKLIVDLERGITQSRPLVDGGTANFDKIFTDLYSKSEEQLINELTDLA
FT                   TIHFDEEVNSLSSSYLSLVRANEYSSIERDYITYVLSRATPLAEEELNKWVSLIAKADT
FT                   FNLEGMNNKPIQSKLQASLYSEDNTDLFLDITTERTAILQASTTGKYETQSGIWFAMIS
FT                   EKIDAINDAEKILIDAMDERASIVKSQAVQVLAIAISIWILGVIIAILGYFFSAEITTN
FT                   IKNLESVLKRVAEDTHDNEAEALRHTINLDTAAGTAQAYALLERIIEQTLNDKQYAMEA
FT                   SEAKSMFLANMSHEIRTPLNGIVGFTELLKDTELHDEQREFIDIIEKSSENLLEIINNI
FT                   LDLSKIESNKLEIEEIVFNPIDEFESAVEVYGVRASEKHIDLACYVDPSLERPLKGDPT
FT                   KIKEVIINLLSNAVKFTNSGGAISVDIRRIECEILNRTRIRFQVKDNGIGVTSEQRSRI
FT                   FEAFSQADTSITRKYGGTGLGLTISSRFVELMGSKLDLESEPGNGTSFFFTLEFEEIET
FT                   LNESLKGSFSNINAVILENHSKKKLQNTYLKEYLDYFGVSYTTFHEQSELKMLERQVNY
FT                   DLLFVDNDYTNDEEMAAYASSQEQLVLITKSFYMKKIDSMGIDIFKVLYEPLNSSKIRT
FT                   TLDAYDAEAFSNRKIKVSRRKKFDEKNSRFAATALVAEDNIINQKLIRRTLEDLGLEIT
FT                   IANNGLEAFEKRKNGSFDIIFMDIQMPVLDGIEATQEILDFEEDYGQNHIPIIALTANA
FT                   LKGDRERFMSAGMDEYTTKPLVRSEIISLLNNFLSHKIVEINPVPKSIHEIAAPSEESL
FT                   PLSSEPDIQPEVHEEPVHDSEFPILSEEVESSEPAEEEGLVEYDADILIAKQNALESKL
FT                   FCHILNDLGYTYKSVASADQLKDELHNRHYKLVMFDKTLSGLHLKDLYDIIHTKKSDTS
FT                   IVMLIDPNVSEEADDAMYVHEIIKNIINKDLLRLVFEKFI"
     MQLGLRNRLR LISLLPILIL FTLASYYVYN AYISYKGAEE LQIRLEGNKQ LNDLINNLSR        60
     ERGMTVMYMG NASPATLKSL HAQRAIVDQK IGIYQEHLAR LEHTNGPEAA KAAALSKLIV       120
     DLERGITQSR PLVDGGTANF DKIFTDLYSK SEEQLINELT DLATIHFDEE VNSLSSSYLS       180
     LVRANEYSSI ERDYITYVLS RATPLAEEEL NKWVSLIAKA DTFNLEGMNN KPIQSKLQAS       240
     LYSEDNTDLF LDITTERTAI LQASTTGKYE TQSGIWFAMI SEKIDAINDA EKILIDAMDE       300
     RASIVKSQAV QVLAIAISIW ILGVIIAILG YFFSAEITTN IKNLESVLKR VAEDTHDNEA       360
     EALRHTINLD TAAGTAQAYA LLERIIEQTL NDKQYAMEAS EAKSMFLANM SHEIRTPLNG       420
     IVGFTELLKD TELHDEQREF IDIIEKSSEN LLEIINNILD LSKIESNKLE IEEIVFNPID       480
     EFESAVEVYG VRASEKHIDL ACYVDPSLER PLKGDPTKIK EVIINLLSNA VKFTNSGGAI       540
     SVDIRRIECE ILNRTRIRFQ VKDNGIGVTS EQRSRIFEAF SQADTSITRK YGGTGLGLTI       600
     SSRFVELMGS KLDLESEPGN GTSFFFTLEF EEIETLNESL KGSFSNINAV ILENHSKKKL       660
     QNTYLKEYLD YFGVSYTTFH EQSELKMLER QVNYDLLFVD NDYTNDEEMA AYASSQEQLV       720
     LITKSFYMKK IDSMGIDIFK VLYEPLNSSK IRTTLDAYDA EAFSNRKIKV SRRKKFDEKN       780
     SRFAATALVA EDNIINQKLI RRTLEDLGLE ITIANNGLEA FEKRKNGSFD IIFMDIQMPV       840
     LDGIEATQEI LDFEEDYGQN HIPIIALTAN ALKGDRERFM SAGMDEYTTK PLVRSEIISL       900
     LNNFLSHKIV EINPVPKSIH EIAAPSEESL PLSSEPDIQP EVHEEPVHDS EFPILSEEVE       960
     SSEPAEEEGL VEYDADILIA KQNALESKLF CHILNDLGYT YKSVASADQL KDELHNRHYK      1020
     LVMFDKTLSG LHLKDLYDII HTKKSDTSIV MLIDPNVSEE ADDAMYVHEI IKNIINKDLL      1080
     RLVFEKFI                                                               1088
//

If you have problems or comments...

PBIL Back to PBIL home page