(data stored in ACNUC7421 zone)

EMBL: CP002355.PE325

CP002355.PE325       Location/Qualifiers
FT   CDS             complement(320612..321028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0326"
FT                   /product="PAS sensor protein"
FT                   /note="InterPro IPR000014: IPR013655: IPR001610: IPR000700;
FT                   KEGG: sun:SUN_1902 signal transduction sensor histidine
FT                   kinase; PFAM: PAS fold-3 domain protein; SMART: PAC
FT                   repeat-containing protein; PAS domain containing protein;
FT                   SPTR: Methyl-accepting chemotaxis sensory transducer with
FT                   Pas/Pac sensor; TIGRFAM: PAS sensor protein; PFAM: PAS
FT                   fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32993"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL6"
FT                   /protein_id="ADR32993.1"
FT                   /translation="MMQKPTPVDEEYLFDGRAIVSETDLKGVITFANRKFCEISGYTVN
FT                   ELIGEPHNIIRHPDMPKAAFAQMWQTIQSGALWHGLVKNLRKDGRYYWVDTEVTPIYDE
FT                   NGKVKGYMAARKPASRKNIEETAALYQKMIEQEQ"
     MMQKPTPVDE EYLFDGRAIV SETDLKGVIT FANRKFCEIS GYTVNELIGE PHNIIRHPDM        60
     PKAAFAQMWQ TIQSGALWHG LVKNLRKDGR YYWVDTEVTP IYDENGKVKG YMAARKPASR       120
     KNIEETAALY QKMIEQEQ                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page