(data stored in ACNUC7421 zone)

EMBL: CP002355.PE326

CP002355.PE326       Location/Qualifiers
FT   CDS             complement(321096..322904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0327"
FT                   /product="Excinuclease ABC subunit C"
FT                   /note="COGs: COG0322 Nuclease subunit of the excinuclease
FT                   complex; InterPro IPR004791: IPR000305: IPR001943:
FT                   IPR001162; KEGG: tdn:Suden_0418 excinuclease ABC subunit C;
FT                   PFAM: excinuclease ABC C subunit domain protein;
FT                   Excinuclease ABC C subunit domain protein; UvrB/UvrC
FT                   protein; SMART: Excinuclease ABC C subunit domain protein;
FT                   SPTR: UvrABC system protein C; TIGRFAM: excinuclease ABC, C
FT                   subunit; PFAM: UvrB/uvrC motif; UvrC Helix-hairpin-helix
FT                   N-terminal; GIY-YIG catalytic domain; TIGRFAM: excinuclease
FT                   ABC, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32994"
FT                   /db_xref="GOA:E4TYL7"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL7"
FT                   /protein_id="ADR32994.1"
FT                   /translation="MIEQIRGLPHQAGIYQYLDEKGRILYIGKAKNLSKRVKSYFNLTP
FT                   SLSPKATLSLRIQKMLSETVGLHYIIVENEHDALILENSLIKQLKPKYNILLRDDKTYP
FT                   YLYVDMDETYPRFELTRKIIKGKSIRYFGPFSVGARDILDSLYELLKLVQKKSCLKGKK
FT                   GCLFYQMEQCLAPCEFPIPHETYLPMVTQGIEWIQNKRKLIKQLEAKMEFYAESLRFEE
FT                   ALVLRDRIDRITKSELTSQIDLASTENYDVFAIALNEVRACILRLFIREGKVASSTHDF
FT                   IPITPYFSIDEAYERTLIGFYGNEKPPIIAPILTAHPFESNDWVQEHLTELFGKKAKIE
FT                   TPQRGAKKELIDLALTNAKELLRTPQPTNEHLLHSIQELLALDSLPRRIEVFDNSHHGG
FT                   SATVGAMIVYENGRFDKKAYRTYHLHERDEYGQMREMLTRRIEAFEKNPPPDLWVLDGG
FT                   ATLRSLATDLLGSHGIHLDVIAISKEKIDAKAHRAKGSARDILHFAEEPLRLESSDKRL
FT                   QFIQMLRDEAHRSAITFHKKTKLKIDQTSKLLAIHGISTPKIHRLLDYFGTFDAIAKSD
FT                   FKTLSELIGAKDAENIQKYYRGNISK"
     MIEQIRGLPH QAGIYQYLDE KGRILYIGKA KNLSKRVKSY FNLTPSLSPK ATLSLRIQKM        60
     LSETVGLHYI IVENEHDALI LENSLIKQLK PKYNILLRDD KTYPYLYVDM DETYPRFELT       120
     RKIIKGKSIR YFGPFSVGAR DILDSLYELL KLVQKKSCLK GKKGCLFYQM EQCLAPCEFP       180
     IPHETYLPMV TQGIEWIQNK RKLIKQLEAK MEFYAESLRF EEALVLRDRI DRITKSELTS       240
     QIDLASTENY DVFAIALNEV RACILRLFIR EGKVASSTHD FIPITPYFSI DEAYERTLIG       300
     FYGNEKPPII APILTAHPFE SNDWVQEHLT ELFGKKAKIE TPQRGAKKEL IDLALTNAKE       360
     LLRTPQPTNE HLLHSIQELL ALDSLPRRIE VFDNSHHGGS ATVGAMIVYE NGRFDKKAYR       420
     TYHLHERDEY GQMREMLTRR IEAFEKNPPP DLWVLDGGAT LRSLATDLLG SHGIHLDVIA       480
     ISKEKIDAKA HRAKGSARDI LHFAEEPLRL ESSDKRLQFI QMLRDEAHRS AITFHKKTKL       540
     KIDQTSKLLA IHGISTPKIH RLLDYFGTFD AIAKSDFKTL SELIGAKDAE NIQKYYRGNI       600
     SK                                                                      602
//

If you have problems or comments...

PBIL Back to PBIL home page