(data stored in ACNUC7421 zone)

EMBL: CP002355.PE327

CP002355.PE327       Location/Qualifiers
FT   CDS             322974..323099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0328"
FT                   /product="LemA family protein"
FT                   /note="KEGG: mct:MCR_0559 LemA family protein; SPTR: LemA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32995"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL8"
FT                   /protein_id="ADR32995.1"
FT                   /translation="MSKMYLFSVIVAVILFLNGCGYKAPPYYEKQTAAKESTVAL"
     MSKMYLFSVI VAVILFLNGC GYKAPPYYEK QTAAKESTVA L                            41
//

If you have problems or comments...

PBIL Back to PBIL home page