(data stored in ACNUC7421 zone)

EMBL: CP002355.PE328

CP002355.PE328       Location/Qualifiers
FT   CDS             323089..324531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0329"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="COGs: COG0029 Aspartate oxidase; InterPro IPR005288:
FT                   IPR003953: IPR004112; KEGG: tdn:Suden_0420 L-aspartate
FT                   oxidase; PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; SPTR: L-aspartate oxidase;
FT                   TIGRFAM: L-aspartate oxidase; PFAM: domain; FAD binding
FT                   domain; TIGRFAM: L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32996"
FT                   /db_xref="GOA:E4TYL9"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL9"
FT                   /protein_id="ADR32996.1"
FT                   /translation="MRYDVVIIGSGVAGLYAAIALPKNLKVLIINKSNPWECNTYYAQG
FT                   GVTTAYNDQDIPSHVQDTLDAGAGMCNATAVQFMSESSQGVIRDLIERGFEFDKDDEGH
FT                   LLYTKEAAHSRSRILHAGGDATGRHLHFFLLNQNSHPMLSDATVVDLLIENNQCCGVEV
FT                   FSEGKRKTILSDNVIIASGGVGSLYEFHTNASTISGDLHGICIEKGIELESMEMMQFHP
FT                   TVFVANDWARKQLLSEALRGEGAHVVDENGYRFLFEYDPRGELAPRDIVSRAIFDYRQR
FT                   SGKQVYLSCEDFESEYFKERFPNIYKSLNDLGFHLPKERVPISPAFHYAVGGIKTNLDG
FT                   SVPGISGLYAAGEAASTGVHGANRLASNSLLEGLVFSKKAAESILEHPLHSCSGDFCIG
FT                   DEPLEIEGDKEKKDRLRRIMWENVSIKRTPDGLNAAYEAINEMLEGEVGRLLKLRLLTA
FT                   QSIVASAQKRTESIGVHYIVEG"
     MRYDVVIIGS GVAGLYAAIA LPKNLKVLII NKSNPWECNT YYAQGGVTTA YNDQDIPSHV        60
     QDTLDAGAGM CNATAVQFMS ESSQGVIRDL IERGFEFDKD DEGHLLYTKE AAHSRSRILH       120
     AGGDATGRHL HFFLLNQNSH PMLSDATVVD LLIENNQCCG VEVFSEGKRK TILSDNVIIA       180
     SGGVGSLYEF HTNASTISGD LHGICIEKGI ELESMEMMQF HPTVFVANDW ARKQLLSEAL       240
     RGEGAHVVDE NGYRFLFEYD PRGELAPRDI VSRAIFDYRQ RSGKQVYLSC EDFESEYFKE       300
     RFPNIYKSLN DLGFHLPKER VPISPAFHYA VGGIKTNLDG SVPGISGLYA AGEAASTGVH       360
     GANRLASNSL LEGLVFSKKA AESILEHPLH SCSGDFCIGD EPLEIEGDKE KKDRLRRIMW       420
     ENVSIKRTPD GLNAAYEAIN EMLEGEVGRL LKLRLLTAQS IVASAQKRTE SIGVHYIVEG       480
//

If you have problems or comments...

PBIL Back to PBIL home page